close all open/close all

CDS information : Strply_00090


close this sectionLocation

Organism
StrainNRRL 2433 (=NBRC 13058)
Entry nameStreptolydigin
Contig
Start / Stop / Direction11,742 / 10,720 / - [in whole cluster]
11,742 / 10,720 / - [in contig]
Locationcomplement(10720..11742) [in whole cluster]
complement(10720..11742) [in contig]
TypeCDS
Length1,023 bp (340 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose C-4 ketoreductase
Product (GenBank)NDP-4-keto-6-deoxyhexose reductase
Gene
Gene (GenBank)slgS5
EC number
Keyword
  • L-rhodinose
Note
Note (GenBank)
Reference
ACC
PmId
[19875077] Deciphering biosynthesis of the RNA polymerase inhibitor streptolydigin and generation of glycosylated derivatives. (Chem Biol. , 2009)
Related Reference
ACC
O33708
NITE
Adria_00200
PmId
[9209071] Cloning and characterization of the Streptomyces peucetius dnmZUV genes encoding three enzymes required for biosynthesis of the daunorubicin precursor thymidine diphospho-L-daunosamine. (J Bacteriol. , 1997)
[10631513] A two-plasmid system for the glycosylation of polyketide antibiotics: bioconversion of epsilon-rhodomycinone to rhodomycin D. (Chem Biol. , 1999)
[9447597] Production of the antitumor drug epirubicin (4'-epidoxorubicin) and its precursor by a genetically engineered strain of Streptomyces peucetius. (Nat Biotechnol. , 1998)

close this sectionSequence

selected fasta
>putative NDP-hexose C-4 ketoreductase [NDP-4-keto-6-deoxyhexose reductase]
MTGREQRDAPGTARRVLVLGGSGFLGRHLTAAFHRAGWQVTAVSRSGEAGQPAGGPEPAA
RMLALDVPGADPGTLTEVLTRTAPHVVVNAAGAVWAASEEEMARGNVLLVDRLLTVLPRL
PRPPRLLQLGTVHEYGPPLGDGPVTEAAALRPVSGYGRTKARASEAVLGAARDGALEATV
LRISNAVGAGLPPASLLGGVAAALAAAPGDGAPAVLRLGPLTARRDFVDATDVAEAVVAA
AAAPAAVPVVNIGRGTSVAAGDLVRRLLAVSGRPAELVERQQPAAVPAAPGGTAYAQRLD
ITLARRALGWRPSRELDDSLRCLWLAAGDPPYASGRGARK
selected fasta
>putative NDP-hexose C-4 ketoreductase [NDP-4-keto-6-deoxyhexose reductase]
GTGACCGGCCGCGAGCAGCGGGACGCCCCCGGCACGGCCCGCCGCGTCCTGGTCCTGGGC
GGCAGCGGCTTCCTCGGCCGGCACCTCACCGCCGCCTTCCACCGCGCGGGCTGGCAGGTC
ACCGCCGTCTCCCGCTCGGGGGAGGCCGGGCAGCCGGCCGGCGGCCCGGAGCCGGCGGCG
CGCATGCTGGCGCTGGACGTGCCGGGTGCGGACCCCGGCACGCTGACCGAGGTCCTGACC
CGGACCGCCCCGCACGTCGTCGTCAACGCCGCGGGCGCGGTGTGGGCCGCGTCCGAGGAG
GAGATGGCCCGCGGCAACGTCCTCCTCGTCGACCGCCTGCTGACCGTCCTGCCGCGGCTG
CCCCGGCCGCCGCGGCTGCTCCAGCTCGGCACCGTCCACGAGTACGGACCGCCCCTGGGC
GACGGCCCGGTCACCGAGGCGGCGGCGCTGCGCCCGGTCTCCGGCTACGGACGGACCAAG
GCACGGGCGAGCGAGGCCGTGCTCGGCGCGGCGCGGGACGGCGCGCTGGAGGCGACGGTG
CTGCGCATCTCCAACGCCGTGGGCGCCGGACTGCCCCCGGCCAGCCTGCTGGGCGGGGTC
GCCGCGGCGCTGGCCGCGGCACCGGGCGACGGCGCCCCGGCCGTCCTGCGGCTCGGCCCG
CTGACCGCCCGCCGCGACTTCGTCGACGCCACCGACGTGGCCGAGGCCGTGGTCGCGGCC
GCCGCCGCGCCGGCCGCCGTACCCGTCGTGAACATCGGCCGGGGCACCTCGGTCGCCGCC
GGGGACCTGGTCCGGCGGCTGCTGGCGGTCAGCGGCCGGCCCGCCGAGCTCGTCGAACGG
CAGCAGCCGGCGGCCGTCCCGGCGGCACCGGGCGGCACCGCTTACGCACAGCGGCTCGAC
ATCACCCTCGCCCGCCGGGCACTGGGCTGGCGACCGAGCAGAGAACTGGACGACTCCCTG
CGGTGTCTGTGGCTCGCGGCCGGCGACCCGCCGTACGCGTCCGGCCGGGGCGCGAGGAAA
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001509 NAD-dependent epimerase/dehydratase (Domain)
 [16-253]  3.5e-37 PF01370
PF01370   Epimerase
IPR016040 NAD(P)-binding domain (Domain)
 [14-217]  9.29999999999998e-25 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP
 [1-31]  0.311 Signal
Bacteria, Gram-positive   
TMHMM No significant hit