close all open/close all

CDS information : Strply_00100


close this sectionLocation

Organism
StrainNRRL 2433 (=NBRC 13058)
Entry nameStreptolydigin
Contig
Start / Stop / Direction12,755 / 11,739 / - [in whole cluster]
12,755 / 11,739 / - [in contig]
Locationcomplement(11739..12755) [in whole cluster]
complement(11739..12755) [in contig]
TypeCDS
Length1,017 bp (338 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose C-3 ketoreductase
Product (GenBank)NDP-hexose-3-ketoreductase
Gene
Gene (GenBank)slgS4
EC number
Keyword
  • L-rhodinose
Note
Note (GenBank)
Reference
ACC
PmId
[19875077] Deciphering biosynthesis of the RNA polymerase inhibitor streptolydigin and generation of glycosylated derivatives. (Chem Biol. , 2009)
Related Reference
ACC
Q9ALN5
NITE
Spino_00080
PmId
[18345667] In vitro characterization of the enzymes involved in TDP-D-forosamine biosynthesis in the spinosyn pathway of Saccharopolyspora spinosa. (J Am Chem Soc. , 2008)

close this sectionSequence

selected fasta
>putative NDP-hexose C-3 ketoreductase [NDP-hexose-3-ketoreductase]
MSTVADPQHREPPLRFGVLGCADIARRRVLPALLRTPGARLTAVASRDSARARQVADTFG
CAPVAGYQALLARDDIDAVYLPLPPALHPEWIRRALTAGKHVLAEKPLTTSSAETAELTA
LAAASGRVLAENVMFVHHPRHERVRRLVADGAVGVPQTFTAAFTVPRRPPGDIRLSAELG
GGALLDIGGYPLRAAQYFLGPDLRVAGAALRTDGAAEVDCGGSALLVAGDGTVAALTFGL
DHAYVSRYEILGSTGRITVDRAFTPPADHVGEIRLDRADGTETLPTPAADQCVNTLAAFV
RAVRTGETAAGHGTMRRQAELIEEIRRAAGMTDREPGR
selected fasta
>putative NDP-hexose C-3 ketoreductase [NDP-hexose-3-ketoreductase]
ATGAGCACCGTGGCCGATCCGCAGCACCGTGAACCCCCGCTCCGCTTCGGCGTCCTGGGC
TGTGCCGACATCGCCCGGCGCCGGGTGCTGCCGGCCCTGCTCCGGACCCCCGGCGCCCGG
CTCACCGCCGTCGCCAGCCGCGATTCCGCCCGTGCCCGGCAGGTCGCCGACACCTTCGGC
TGCGCCCCGGTGGCCGGGTACCAGGCCCTGCTGGCACGCGACGACATCGACGCCGTGTAC
CTGCCCCTGCCCCCGGCCCTGCACCCGGAGTGGATCCGGCGCGCCCTCACGGCCGGCAAG
CACGTCCTCGCCGAGAAGCCGCTCACCACGAGCAGCGCCGAGACCGCCGAACTGACCGCG
CTGGCCGCCGCCTCGGGACGGGTGCTGGCCGAGAACGTGATGTTCGTGCACCACCCGCGG
CACGAACGGGTACGCCGGCTCGTCGCCGACGGCGCCGTCGGGGTGCCGCAGACGTTCACC
GCCGCCTTCACCGTCCCCCGGCGGCCGCCGGGCGACATCCGGCTCTCCGCGGAGCTGGGC
GGCGGCGCGCTGCTGGACATCGGCGGCTATCCGCTGCGCGCCGCCCAGTACTTCCTCGGC
CCGGACCTGCGGGTCGCCGGCGCGGCCCTGCGCACCGACGGGGCGGCCGAAGTCGACTGC
GGGGGCAGCGCGTTGCTGGTCGCCGGCGACGGCACGGTGGCCGCGCTTACGTTCGGCCTC
GACCACGCCTATGTGAGTCGCTACGAGATTCTCGGCAGCACCGGCCGGATCACCGTCGAC
CGCGCCTTCACCCCGCCCGCCGACCACGTCGGAGAGATCCGGCTGGACCGCGCCGACGGC
ACCGAAACCCTCCCCACCCCCGCCGCCGACCAGTGCGTCAACACCCTCGCCGCCTTCGTC
CGCGCCGTACGCACCGGTGAAACGGCCGCCGGGCACGGGACGATGCGGCGCCAGGCGGAG
CTGATCGAGGAGATCCGCCGCGCCGCCGGGATGACGGACCGGGAGCCGGGCCGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000683 Oxidoreductase, N-terminal (Domain)
 [14-130]  4.9e-27 PF01408
PF01408   GFO_IDH_MocA
IPR004104 Oxidoreductase, C-terminal (Domain)
 [145-250]  3.4e-07 PF02894
PF02894   GFO_IDH_MocA_C
IPR016040 NAD(P)-binding domain (Domain)
 [11-155]  3.89999999999997e-43 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP
 [1-45]  0.335 Signal
Bacteria, Gram-positive   
TMHMM No significant hit