close all open/close all

CDS information : Strply_00110


close this sectionLocation

Organism
StrainNRRL 2433 (=NBRC 13058)
Entry nameStreptolydigin
Contig
Start / Stop / Direction14,104 / 12,752 / - [in whole cluster]
14,104 / 12,752 / - [in contig]
Locationcomplement(12752..14104) [in whole cluster]
complement(12752..14104) [in contig]
TypeCDS
Length1,353 bp (450 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose 2,3-dehydratase
Product (GenBank)NDP-hexose-2,3-dehydratase
Gene
Gene (GenBank)slgS3
EC number
Keyword
  • L-rhodinose
Note
Note (GenBank)
Reference
ACC
PmId
[19875077] Deciphering biosynthesis of the RNA polymerase inhibitor streptolydigin and generation of glycosylated derivatives. (Chem Biol. , 2009)
Related Reference
ACC
Q9ZA32
NITE
Grana_00210
PmId
[9831526] The granaticin biosynthetic gene cluster of Streptomyces violaceoruber Tu22: sequence analysis and expression in a heterologous host. (Chem Biol. , 1998)
ACC
Q9ALN6
NITE
Spino_00070
PmId
[18345667] In vitro characterization of the enzymes involved in TDP-D-forosamine biosynthesis in the spinosyn pathway of Saccharopolyspora spinosa. (J Am Chem Soc. , 2008)

close this sectionSequence

selected fasta
>putative NDP-hexose 2,3-dehydratase [NDP-hexose-2,3-dehydratase]
MTTTAVPPRAPAFQEWFEARKAAHEHRVRPLALDRLDGWRFHEDTGNLVHRSGRFFTVEG
LRTYVGEEGRARWSQPVIVQPETGILGILVKRFGTVPYCLMQAKMEPGNINTLQLSPTVQ
ATRSNYTRVHQGNRVPYLEHFTAPRRGRVLLDVLQSEQGAWFLGKRNRNMIVEVEPDEDV
PVLDDFRWVELAELRSLLHTDNLVNMDSRTVLSGMPPTPPAAGTAGTDGFFRPAPDGRAR
HDTAYLRSWFTEARTANPLVQRRVPLADLADWEYRDGRLAHRQGGPFTVIGVDVEAGGRE
VPHWTQPMVAPTGRGLAAFLVRRLDGVPHVLVKAHTEPGTFDAVEMGPTVQCFPGRDDRD
DPAERPPYLDRIRTAPPSAVRFDAVHSEEGGRFHHAETRYVIAEAGPDAERDVPDTHVWM
TVEQLTGFVRCGGHVNVEARSLLACLHTLG
selected fasta
>putative NDP-hexose 2,3-dehydratase [NDP-hexose-2,3-dehydratase]
ATGACCACCACCGCCGTCCCGCCGCGGGCGCCCGCCTTCCAGGAGTGGTTCGAGGCCCGC
AAGGCCGCCCACGAGCACCGGGTACGGCCCCTCGCGCTGGACCGGCTCGACGGCTGGCGG
TTCCACGAGGACACCGGGAACCTCGTCCACCGCAGCGGCCGGTTCTTCACGGTCGAGGGG
CTCCGGACGTACGTCGGCGAAGAGGGCCGGGCCCGCTGGAGCCAGCCGGTCATCGTGCAG
CCGGAGACCGGCATCCTCGGCATCCTCGTCAAGCGGTTCGGGACGGTGCCGTACTGCCTG
ATGCAGGCGAAGATGGAGCCGGGCAACATCAACACGCTGCAGCTCTCGCCGACCGTCCAG
GCCACCCGCAGCAACTACACCCGCGTCCACCAGGGCAACCGCGTCCCCTACCTGGAGCAC
TTCACCGCGCCCCGCCGCGGCCGGGTCCTGCTGGACGTCCTGCAGTCCGAACAGGGCGCG
TGGTTCCTCGGCAAGCGCAACCGCAACATGATCGTCGAGGTGGAACCGGACGAGGACGTG
CCCGTCCTGGACGACTTCCGGTGGGTCGAACTGGCCGAACTCCGCTCCCTGCTGCACACC
GACAACCTCGTCAACATGGACTCCCGCACCGTCCTGTCCGGCATGCCGCCGACCCCACCG
GCCGCCGGAACGGCCGGGACCGACGGCTTCTTCCGGCCCGCGCCCGACGGCCGCGCACGG
CACGACACCGCGTATCTGCGCAGCTGGTTCACCGAGGCCCGGACCGCGAACCCCCTGGTG
CAGCGCCGGGTTCCGCTGGCGGACCTGGCCGACTGGGAGTACCGCGACGGGCGCCTCGCG
CACCGGCAGGGCGGCCCGTTCACCGTCATCGGTGTCGACGTCGAGGCCGGCGGCCGTGAG
GTGCCGCACTGGACCCAGCCCATGGTGGCCCCCACGGGCCGTGGACTGGCCGCCTTCCTC
GTCCGGCGGCTCGACGGCGTGCCGCATGTGCTGGTCAAGGCCCACACCGAGCCCGGCACC
TTCGACGCGGTGGAGATGGGCCCGACCGTGCAGTGCTTCCCCGGCCGGGACGACCGGGAC
GACCCCGCCGAACGGCCCCCGTACCTGGACCGGATCCGCACCGCCCCGCCGTCCGCCGTG
CGCTTCGACGCCGTGCATTCCGAGGAGGGCGGACGCTTCCACCACGCCGAGACCCGCTAT
GTGATCGCCGAGGCCGGCCCGGACGCGGAGCGCGACGTGCCGGACACCCACGTGTGGATG
ACGGTGGAACAACTCACCGGGTTCGTCCGCTGCGGCGGCCACGTCAATGTCGAAGCCCGC
AGCCTGCTGGCGTGCCTGCACACCCTGGGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005212 NDP-hexose 2,3-dehydratase (Domain)
 [12-214]  2.90000000000003e-80 PF03559 [242-446]  7.40000000000007e-72 PF03559
PF03559   Hexose_dehydrat
SignalP
 [1-22]  0.185 Signal
Bacteria, Gram-positive   
TMHMM No significant hit