close all open/close all

CDS information : Strply_00140


close this sectionLocation

Organism
StrainNRRL 2433 (=NBRC 13058)
Entry nameStreptolydigin
Contig
Start / Stop / Direction16,402 / 17,577 / + [in whole cluster]
16,402 / 17,577 / + [in contig]
Location16402..17577 [in whole cluster]
16402..17577 [in contig]
TypeCDS
Length1,176 bp (391 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative glycosyltransferase
Product (GenBank)glycosyltransferase
Gene
Gene (GenBank)slgG
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[19875077] Deciphering biosynthesis of the RNA polymerase inhibitor streptolydigin and generation of glycosylated derivatives. (Chem Biol. , 2009)
Related Reference
ACC
C4NCL8
PmId
[20418426] Formation and attachment of the deoxysugar moiety and assembly of the gene cluster for caprazamycin biosynthesis. (Appl Environ Microbiol. , 2010)
ACC
Q76KZ6
NITE
Vicen_00040
PmId
[15112997] Cloning, sequencing, and functional analysis of the biosynthetic gene cluster of macrolactam antibiotic vicenistatin in Streptomyces halstedii. (Chem Biol. , 2004)
[17388594] Substrate flexibility of vicenisaminyltransferase VinC involved in the biosynthesis of vicenistatin. (J Am Chem Soc. , 2007)

close this sectionSequence

selected fasta
>putative glycosyltransferase [glycosyltransferase]
MRALFMFLSGFSHISPSIPLAWALRSAGHEVLYTGTGERTRVVAESGLSMADTAPESDVE
AVLVNRPGTQHQAPGETQEESDRIAHLSGMFDPAKIIDARDAARIAETFAGFAALTLDGD
LEIARRWRPDVIIHEPSHIGAPLVATRLGIPRVQLEIHLQGVDRFFHPQFTRWLAAHHGV
PAVEPPAVALGMAPPSVVPPEPTARPMRYLPHNGGGILPDWVTRPAGRPRVCLTLGTVVP
GVEGVGHLKRVVHEAARSGAEIVLAVGDSDLSALGDLPANVRPTGWIPLHELLPTCAAVV
HHGGDGTTFTALARGVPQLIVPHGNEQLLNTKAVAGRGVGIGVELDAFTTGHLSALLEDA
AYRAAAEEVRTEIEAMPAPADTVPSLVRLLS
selected fasta
>putative glycosyltransferase [glycosyltransferase]
ATGCGGGCGCTGTTCATGTTCCTGTCCGGCTTCAGCCATATCTCTCCGTCCATTCCGTTG
GCCTGGGCATTACGGTCGGCCGGGCACGAGGTTCTGTACACCGGAACCGGTGAACGGACC
CGAGTGGTCGCCGAATCGGGGCTCTCCATGGCCGATACGGCCCCGGAGTCGGACGTGGAA
GCGGTCCTTGTGAACCGCCCCGGAACTCAGCACCAGGCGCCCGGAGAAACCCAAGAGGAA
AGCGACCGCATAGCCCATCTTTCGGGGATGTTCGACCCCGCGAAGATTATCGACGCGCGG
GACGCGGCACGTATCGCCGAAACTTTCGCGGGTTTTGCCGCACTCACCCTGGACGGCGAT
CTGGAAATCGCCCGGCGCTGGCGTCCGGACGTCATCATCCATGAGCCGTCCCATATCGGA
GCCCCCCTGGTGGCCACCCGGCTCGGAATTCCCCGGGTGCAGCTGGAGATTCATCTGCAG
GGCGTGGACCGCTTCTTCCACCCGCAGTTCACCCGGTGGCTGGCCGCGCACCACGGCGTA
CCCGCCGTCGAACCCCCCGCCGTCGCCCTCGGCATGGCGCCGCCCAGCGTCGTCCCGCCC
GAGCCCACGGCCCGGCCGATGCGCTATCTGCCGCACAACGGCGGCGGGATCCTCCCGGAC
TGGGTGACCCGGCCTGCCGGACGCCCCCGGGTGTGCCTCACGCTGGGCACGGTGGTCCCC
GGCGTGGAAGGGGTGGGCCACCTCAAGCGGGTGGTGCACGAAGCGGCCCGTTCCGGCGCG
GAGATCGTGCTGGCGGTCGGCGACAGCGACCTGTCGGCGCTGGGCGACCTCCCCGCCAAC
GTCCGCCCCACCGGCTGGATCCCGCTGCACGAACTCCTGCCGACCTGTGCAGCCGTGGTG
CACCACGGCGGCGACGGTACGACCTTCACCGCCCTGGCCCGCGGCGTACCGCAGCTGATC
GTGCCGCACGGCAACGAACAGCTCCTCAACACCAAGGCGGTGGCCGGCCGCGGGGTCGGC
ATCGGCGTCGAGCTGGACGCCTTCACCACCGGTCACCTCTCGGCGCTGCTGGAGGACGCG
GCCTACCGCGCCGCCGCCGAGGAGGTGCGTACGGAGATCGAGGCGATGCCCGCCCCGGCG
GACACCGTGCCCTCCCTCGTACGCCTCCTGTCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004276 Glycosyl transferase, family 28 (Domain)
 [13-153]  1.1e-08 PF03033
PF03033   Glyco_transf_28
IPR010610 Domain of unknown function DUF1205 (Domain)
 [192-282]  1.4e-23 PF06722
PF06722   DUF1205
SignalP
 [1-23]  0.984 Signal
Eukaryota   
 [1-14]  0.579 Signal
Bacteria, Gram-negative   
 [1-23]  0.666 Signal
Bacteria, Gram-positive   
TMHMM No significant hit