close all open/close all

CDS information : Strply_00150


close this sectionLocation

Organism
StrainNRRL 2433 (=NBRC 13058)
Entry nameStreptolydigin
Contig
Start / Stop / Direction18,302 / 19,282 / + [in whole cluster]
18,302 / 19,282 / + [in contig]
Location18302..19282 [in whole cluster]
18302..19282 [in contig]
TypeCDS
Length981 bp (326 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative 3-methyl-asparagine synthetase
Product (GenBank)asparaginyl-tRNA synthetase-like
Gene
Gene (GenBank)slgZ
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[19875077] Deciphering biosynthesis of the RNA polymerase inhibitor streptolydigin and generation of glycosylated derivatives. (Chem Biol. , 2009)
[21398531] Biosynthesis of the RNA polymerase inhibitor streptolydigin in Streptomyces lydicus: tailoring modification of 3-methyl-aspartate. (J Bacteriol. , 2011)

close this sectionSequence

selected fasta
>putative 3-methyl-asparagine synthetase [asparaginyl-tRNA synthetase-like]
MSQLPPSPRKHLDSPRTRAVLRIQQQIVSAARDHLRALGFVELLPPVIGPATDPGGRGAK
QVDVDYYGHRYKLMTSAIMYKQAALLSFDKIFCVAPNVRLEPPETCSTQRHLAEFHQFDV
EIAGAGAQDAMGVAEDLVRAAVRSVTEQLPADLDVLGRDPDAFADLLAQPFDRLTHATAV
AELAVLGHEQNPDAEIDWEGEAMLSRKATRPFFVTSYPKGSRGFYDREDPEVPGTLRNFD
LLAAEGFGELISGAEREFDHARIVTRMRETGENPGKYQHFLEVAREGIPASAGFGIGIER
LTRYVCGLDAVWEATAFPKIPGVVSL
selected fasta
>putative 3-methyl-asparagine synthetase [asparaginyl-tRNA synthetase-like]
ATGAGCCAGCTGCCGCCCTCACCCCGGAAGCACCTCGACAGCCCCCGCACCCGCGCCGTT
CTGCGCATCCAGCAGCAGATCGTCTCCGCGGCCCGCGACCATCTGCGCGCGCTCGGCTTC
GTCGAGCTGCTGCCGCCCGTCATCGGCCCGGCCACCGACCCCGGCGGGCGCGGCGCCAAG
CAGGTCGACGTCGACTACTACGGGCACCGCTACAAGCTGATGACCAGCGCGATCATGTAC
AAGCAGGCTGCGCTGCTGTCCTTCGACAAGATCTTCTGCGTGGCGCCCAACGTCCGTCTG
GAGCCGCCGGAGACCTGCTCGACCCAACGGCACCTCGCCGAATTCCACCAGTTCGACGTG
GAGATCGCGGGCGCCGGCGCGCAGGACGCGATGGGCGTCGCCGAGGACCTCGTCCGTGCC
GCGGTGCGTTCGGTCACCGAGCAGCTGCCCGCGGACCTCGACGTGCTCGGCCGGGACCCG
GACGCCTTCGCCGACCTGCTCGCCCAGCCATTCGACCGCCTCACCCACGCCACGGCGGTC
GCCGAGCTGGCCGTCCTGGGACACGAGCAGAACCCGGACGCGGAGATCGACTGGGAGGGC
GAGGCGATGCTGTCCCGCAAGGCCACCCGCCCGTTCTTCGTCACCAGCTACCCGAAGGGC
TCGCGCGGTTTCTACGACCGCGAGGACCCCGAAGTGCCCGGCACCCTGCGGAACTTCGAC
CTGCTGGCGGCCGAGGGGTTCGGCGAGCTGATCAGCGGTGCGGAGCGGGAGTTCGACCAC
GCGCGGATCGTCACGCGGATGCGGGAGACCGGCGAGAACCCCGGCAAGTACCAGCACTTC
CTGGAGGTGGCCCGGGAGGGCATTCCGGCCAGTGCCGGGTTCGGCATCGGCATCGAGCGC
CTGACCCGCTACGTGTGCGGCCTGGACGCGGTCTGGGAGGCCACCGCGTTCCCGAAGATC
CCCGGCGTGGTGTCGTTGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004364 Aminoacyl-tRNA synthetase, class II (D/K/N) (Domain)
 [11-320]  7.10000000000008e-54 PF00152
PF00152   tRNA-synt_2
IPR006195 Aminoacyl-tRNA synthetase, class II (Domain)
 [21-318]  PS50862
PS50862   AA_TRNA_LIGASE_II
SignalP
 [1-30]  0.396 Signal
Bacteria, Gram-positive   
TMHMM No significant hit