close all open/close all

CDS information : Strply_00160


close this sectionLocation

Organism
StrainNRRL 2433 (=NBRC 13058)
Entry nameStreptolydigin
Contig
Start / Stop / Direction19,279 / 20,601 / + [in whole cluster]
19,279 / 20,601 / + [in contig]
Location19279..20601 [in whole cluster]
19279..20601 [in contig]
TypeCDS
Length1,323 bp (440 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative glutamate synthase
Product (GenBank)ferredoxin-dependent glutamate synthase
Gene
Gene (GenBank)slgE3
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[19875077] Deciphering biosynthesis of the RNA polymerase inhibitor streptolydigin and generation of glycosylated derivatives. (Chem Biol. , 2009)
[21665968] Amino acid precursor supply in the biosynthesis of the RNA polymerase inhibitor streptolydigin by Streptomyces lydicus. (J Bacteriol. , 2011)

close this sectionSequence

selected fasta
>putative glutamate synthase [ferredoxin-dependent glutamate synthase]
MTGGSGLSAPGFPEAAVRERARSGTAAAFPPLSGYGHTLLGAAPGAPEAGAPYGTPGELL
ETGRLVPPVFMPRRLEKLIELGREPQHSDVDLTTDIGGFQAPLPLYVSAFGSTRAAGDGL
GTAVGRQAGSLGLPLVIGENVLPVSGYGRPGTASDGGGNAAGLLRRIRAYADELPDGVGG
IAVQQSTEDADAEVWNLVHSDPHVQPLLASGRLAFELKVGQGAKPGLGGMTLVDAAEADR
LADRYRVQDTLGEKGDVLRCSAPGTVTEEILRQQIRFMRSNYPRVRVWVKLFPGRDVDRA
AAVAWQAGADAVTVDGAEGGSGWAPHAFLDGVGLPLGECLRRIAAGPHPLLVSGRMWEGG
RVARSLALGARAAGLGRAALLAADEDPDRGLIRLTACLELELRLLVSALGKYAAAELAPE
DLWPQPAAERRPDPTTREPS
selected fasta
>putative glutamate synthase [ferredoxin-dependent glutamate synthase]
GTGACCGGCGGCAGCGGGCTGTCTGCCCCGGGGTTCCCCGAGGCAGCGGTGCGCGAGCGG
GCACGTTCGGGCACCGCCGCGGCCTTCCCGCCGCTCTCCGGCTACGGGCACACGCTGCTC
GGCGCGGCCCCCGGCGCACCCGAGGCGGGCGCCCCGTACGGCACGCCCGGTGAGCTGCTG
GAGACCGGGCGCCTGGTGCCGCCGGTGTTCATGCCGCGGCGGCTGGAGAAGCTCATCGAG
CTGGGCCGCGAGCCCCAGCACTCCGATGTCGACCTGACCACCGACATCGGCGGCTTCCAG
GCCCCGCTGCCGCTGTACGTCTCGGCGTTCGGCTCGACCCGCGCCGCCGGCGACGGCCTC
GGCACCGCCGTCGGCCGGCAGGCGGGCAGCCTCGGTCTGCCCCTGGTCATCGGGGAGAAC
GTGCTGCCCGTCAGCGGCTACGGACGGCCCGGCACCGCGTCCGACGGCGGCGGGAACGCC
GCCGGCCTGCTGCGCCGCATCCGCGCGTACGCCGACGAACTGCCCGACGGCGTCGGCGGC
ATCGCCGTGCAGCAGAGCACCGAGGACGCCGACGCCGAGGTGTGGAACCTGGTGCACAGC
GACCCGCACGTCCAGCCGCTGCTGGCGTCCGGGCGGCTGGCCTTCGAGCTCAAGGTCGGC
CAGGGCGCCAAACCGGGCCTGGGCGGGATGACCCTGGTGGACGCGGCGGAGGCGGACCGG
CTGGCCGATCGCTACCGGGTGCAGGACACCCTCGGCGAGAAGGGCGACGTGCTGCGCTGC
AGTGCGCCGGGCACCGTCACCGAGGAGATCCTGCGCCAGCAGATCCGCTTCATGCGCAGC
AACTATCCGCGGGTCCGGGTGTGGGTGAAGCTCTTCCCGGGCCGGGACGTGGACCGGGCC
GCGGCGGTGGCGTGGCAGGCCGGTGCCGACGCGGTGACCGTCGACGGCGCCGAGGGCGGC
TCCGGCTGGGCACCGCACGCGTTCCTCGACGGCGTCGGGCTGCCGCTGGGCGAGTGCCTG
CGCCGGATCGCTGCGGGGCCGCACCCGCTGCTGGTCAGCGGGCGGATGTGGGAGGGCGGC
CGGGTGGCCAGGAGCCTGGCCCTGGGCGCCCGCGCGGCCGGTCTGGGCCGGGCCGCGCTG
CTGGCCGCCGACGAGGACCCGGACCGCGGGCTGATCCGGCTGACCGCCTGCCTGGAGCTC
GAACTGCGCCTTCTGGTCAGCGCGTTGGGAAAGTACGCGGCGGCCGAACTGGCCCCGGAG
GACCTGTGGCCGCAGCCGGCCGCCGAGCGGCGGCCGGACCCGACGACGAGGGAGCCCTCG
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002932 Glutamate synthase, central-C (Domain)
 [211-383]  3.7e-16 PF01645
PF01645   Glu_synthase
IPR013785 Aldolase-type TIM barrel (Domain)
 [87-150]  5.89999999999994e-33 G3DSA:3.20.20.70 [182-422]  5.89999999999994e-33 G3DSA:3.20.20.70
G3DSA:3.20.20.70   Aldolase_TIM
SignalP No significant hit
TMHMM No significant hit