close all open/close all

CDS information : Strply_00170


close this sectionLocation

Organism
StrainNRRL 2433 (=NBRC 13058)
Entry nameStreptolydigin
Contig
Start / Stop / Direction20,598 / 22,301 / + [in whole cluster]
20,598 / 22,301 / + [in contig]
Location20598..22301 [in whole cluster]
20598..22301 [in contig]
TypeCDS
Length1,704 bp (567 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.2 NRPS
Productnon-ribosomal peptide synthetase adenylation domain protein
Product (GenBank)non-ribosomal peptide synthetase
Gene
Gene (GenBank)slgN1
EC number
Keyword
  • 3-methylaspartate
Note
  • A domain seems to be imcomplete.
  • According to the reference, NRPS is composed of SlgN1, SlgN2 and SlgL.
  • SlgN1 recognizes (2S,3S)-3-methylaspartate as an alpha-amino acid substrate and adenylates the carboxyl group at the C1 position.
Note (GenBank)
Reference
ACC
PmId
[19875077] Deciphering biosynthesis of the RNA polymerase inhibitor streptolydigin and generation of glycosylated derivatives. (Chem Biol. , 2009)
[22569159] Novel compounds produced by Streptomyces lydicus NRRL 2433 engineered mutants altered in the biosynthesis of streptolydigin. (J Antibiot (Tokyo). , 2012)
[23192349] Structural Basis of the Interaction of MbtH-Like Proteins, Putative Regulators of Non-Ribosomal Peptide Biosynthesis, with Adenylating Enzymes. (J Biol Chem. , 2012)

close this sectionPKS/NRPS Module

8
A99..496

close this sectionSequence

selected fasta
>non-ribosomal peptide synthetase adenylation domain protein [non-ribosomal peptide synthetase]
MSNPFEEYDGGHVVLTDALGRHSLWPAGIAVPAGWSVRHGTDSREGCLAHIEHHWTDLRP
TGPAVERAPAGACVHELFEAQAARAPDAVALLHEADELTYGALNERANRLAHRLVGLGVA
PGTLVGVHLERGFDMVVALLAVLKAGGGYTMLDPQFPVERLALSLEDTGAPLLVTSRPLS
GRLTGTTTLYVEDEAASDAPAGNLATGVGPEDVACVMFTSGSTGRPKGVMSPHRALTGTY
LGQDYAGFGPDEVFLQCSPVSWDAFGLELFGALLFGARCVLQSGQNPDPLEIGELVARHG
VTMLQLSASLFNFLVDEVPEAFEGVRYAITGGEPASVPHVAKARRDHPALRLGNGYGPAE
SMGFTTHHAVVAGDLSGTALPIGVPLAGKRAYVLDDDLKPAANGALGELYVAGAGLAHGY
VSRPALTAERFVADPFAGPGGERMYRTGDLARRRADGVLEYVGRADDQVKIRGFRVEPGE
VEARLVGHPAVRQAAVLAQDSRLGDKQLVAYVVAERADAPPDAAELRRHVAEALPAYMVP
VECVPVDELPRTPNGKLDRRALTGSGS
selected fasta
>non-ribosomal peptide synthetase adenylation domain protein [non-ribosomal peptide synthetase]
GTGAGCAATCCGTTCGAGGAGTACGACGGCGGCCATGTGGTCCTCACGGACGCCCTGGGC
CGCCACAGCCTGTGGCCCGCCGGCATCGCCGTACCCGCCGGCTGGTCGGTGCGCCACGGC
ACCGACAGCCGGGAGGGCTGCCTGGCGCACATCGAGCACCACTGGACCGACCTGCGGCCC
ACCGGGCCCGCCGTGGAGCGGGCGCCCGCCGGGGCGTGCGTGCACGAGCTGTTCGAGGCG
CAGGCCGCGCGGGCTCCCGACGCCGTCGCCCTGCTCCACGAAGCCGACGAGCTGACCTAC
GGCGCGCTCAACGAGCGGGCCAACCGTCTCGCGCACCGGCTGGTGGGGCTCGGCGTCGCA
CCGGGCACGCTGGTCGGCGTCCATCTGGAGCGCGGCTTCGACATGGTGGTGGCGCTGCTG
GCGGTGCTCAAGGCGGGCGGCGGCTACACCATGCTCGACCCGCAGTTCCCGGTGGAACGG
CTGGCCCTGTCCCTGGAGGACACCGGCGCGCCGCTGCTCGTCACCTCGCGGCCGCTGAGC
GGCCGGCTGACGGGCACGACCACCCTGTACGTCGAGGACGAGGCGGCGTCCGACGCCCCC
GCCGGGAACTTGGCCACCGGGGTCGGCCCGGAGGACGTCGCGTGCGTGATGTTCACCTCC
GGCTCCACCGGCCGGCCCAAGGGTGTGATGTCCCCGCACCGCGCCCTGACCGGCACGTAT
CTCGGGCAGGACTACGCGGGGTTCGGGCCCGACGAGGTCTTCCTCCAGTGCTCCCCGGTG
TCCTGGGACGCCTTCGGCCTGGAGCTGTTCGGTGCCCTGCTGTTCGGCGCGCGCTGTGTG
CTCCAGTCCGGCCAGAACCCGGACCCGCTGGAGATCGGCGAGCTGGTGGCGCGGCACGGG
GTGACCATGCTCCAGCTCTCGGCGAGCCTGTTCAACTTCCTGGTGGACGAGGTGCCGGAG
GCGTTCGAGGGGGTGCGCTACGCGATCACCGGCGGCGAGCCGGCGTCCGTCCCGCACGTC
GCCAAGGCCCGCCGGGACCACCCGGCGCTGCGTCTCGGCAACGGCTACGGCCCGGCCGAG
AGCATGGGCTTCACCACCCACCACGCGGTCGTCGCCGGGGACCTGTCGGGCACCGCCCTG
CCGATCGGCGTGCCCCTCGCCGGCAAGCGGGCCTACGTCCTGGACGACGACCTCAAACCC
GCGGCGAACGGGGCGCTGGGCGAGCTGTACGTGGCGGGCGCCGGGCTGGCCCACGGCTAT
GTCAGCCGCCCGGCGCTGACCGCTGAACGGTTCGTCGCCGATCCCTTCGCCGGTCCGGGC
GGGGAGCGGATGTACCGCACCGGCGATCTGGCCCGGCGGCGGGCGGACGGGGTGCTGGAG
TACGTGGGGCGCGCCGACGACCAGGTCAAGATCCGCGGCTTCAGGGTCGAGCCGGGCGAG
GTGGAGGCGCGGCTGGTCGGCCACCCCGCGGTGCGGCAGGCGGCGGTGCTGGCCCAGGAC
TCGCGGCTCGGCGACAAGCAGCTGGTCGCGTACGTGGTGGCCGAGCGGGCGGACGCGCCA
CCGGACGCGGCGGAGCTGCGCCGGCATGTGGCCGAGGCGCTGCCCGCGTACATGGTGCCG
GTGGAGTGTGTGCCGGTGGACGAGCTGCCGCGGACGCCGAACGGGAAGCTGGACCGGCGG
GCCCTGACCGGCAGCGGGAGCTGA
[8] A99..496
[8] A295..1488

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [99-496]  5.90000000000008e-108 PF00501
PF00501   AMP-binding
IPR003043 Uroporphiryn-III C-methyltransferase, conserved site (Conserved_site)
 [89-122]  PS00840
PS00840   SUMT_2
IPR005153 MbtH-like protein (Domain)
 [1-52]  9.10000000000001e-17 PF03621
PF03621   MbtH
 [3-53]  2.19999900980708e-17 SM00923
SM00923   MbtH
IPR010071 Amino acid adenylation domain (Domain)
 [99-496]  5.20000000000001e-122 TIGR01733
TIGR01733   AA-adenyl-dom
IPR015166 Protein of unknown function DUF1922 (Family)
 [12-61]  2.7e-18 G3DSA:3.90.820.10
G3DSA:3.90.820.10   DUF1922
IPR020845 AMP-binding, conserved site (Conserved_site)
 [216-227]  PS00455
PS00455   AMP_BINDING
IPR025110 Domain of unknown function DUF4009 (Domain)
 [537-562]  9e-06 PF13193
PF13193   DUF4009
SignalP No significant hit
TMHMM No significant hit