close all open/close all

CDS information : Strply_00180


close this sectionLocation

Organism
StrainNRRL 2433 (=NBRC 13058)
Entry nameStreptolydigin
Contig
Start / Stop / Direction23,435 / 22,449 / - [in whole cluster]
23,435 / 22,449 / - [in contig]
Locationcomplement(22449..23435) [in whole cluster]
complement(22449..23435) [in contig]
TypeCDS
Length987 bp (328 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative dTDP-glucose 4,6-dehydratase
Product (GenBank)NDP-glucose-4,6-dehydratase
Gene
Gene (GenBank)slgS2
EC number4.2.1.46
Keyword
  • L-rhodinose
Note
Note (GenBank)
Reference
ACC
PmId
[19875077] Deciphering biosynthesis of the RNA polymerase inhibitor streptolydigin and generation of glycosylated derivatives. (Chem Biol. , 2009)
Related Reference
ACC
Q54116
PmId
[7883182] Cloning of the genes encoding thymidine diphosphoglucose 4,6-dehydratase and thymidine diphospho-4-keto-6-deoxyglucose 3,5-epimerase from the erythromycin-producing Saccharopolyspora erythraea. (Gene. , 1995)
ACC
Q194R3
NITE
Mith_00070
PmId
[9150235] Cloning and insertional inactivation of Streptomyces argillaceus genes involved in the earliest steps of biosynthesis of the sugar moieties of the antitumor polyketide mithramycin. (J Bacteriol. , 1997)

close this sectionSequence

selected fasta
>putative dTDP-glucose 4,6-dehydratase [NDP-glucose-4,6-dehydratase]
MNILVTGGAGFIGSHYVRTLLGTPGAADCGRLTVLDKLTYAGNTANLATVWDDPRFTFVR
GDVCDAGLVDKLVADHDTVVHFAAESHVDRSIAGASDFIMSNVVGTQTLLDAALHHQDSF
GTFVLISTDEVYGSIDTGSWTESHPVAPNSPYAAAKASSDLITLAYGRTHGLDVRVTRCS
NNFGHHHFPEKLIPLFVTNLLDGKQVPLYGDGLHIRDWLHIDDHVQGIELVRTKGRPGEV
YNIGGGTELSNTALTGRLLEACGAGWERVDHVADRKGHDRRYSVDWTKIRTELGYAPHRD
FDSALAETIDWYRTHREWWEPLKRRAGL
selected fasta
>putative dTDP-glucose 4,6-dehydratase [NDP-glucose-4,6-dehydratase]
ATGAACATCCTGGTCACGGGAGGCGCCGGATTCATCGGCTCGCACTACGTCCGGACGCTG
CTGGGCACGCCCGGTGCCGCGGACTGCGGCCGGCTGACGGTGCTGGACAAGCTCACCTAC
GCCGGCAACACCGCCAACCTCGCCACCGTGTGGGACGACCCGCGGTTCACCTTCGTGCGC
GGCGACGTCTGTGACGCCGGGCTGGTCGACAAGCTCGTCGCGGACCACGACACCGTGGTG
CACTTCGCCGCGGAGTCACACGTCGACCGCTCCATCGCCGGCGCGTCCGACTTCATCATG
TCCAACGTCGTCGGCACCCAGACCCTGCTGGACGCGGCGCTGCACCATCAGGACTCCTTC
GGCACCTTCGTCCTCATATCGACCGACGAGGTCTACGGCTCCATCGACACCGGTTCCTGG
ACCGAGAGCCACCCCGTCGCCCCCAACTCCCCGTACGCCGCGGCCAAGGCGTCCAGCGAC
CTGATCACGCTGGCCTACGGGCGCACCCACGGCCTCGACGTACGGGTCACGCGGTGCTCC
AACAACTTCGGCCACCACCACTTCCCCGAGAAGCTCATCCCGCTGTTCGTCACCAACCTC
CTGGACGGCAAGCAGGTCCCGCTGTACGGCGACGGCCTGCACATCCGCGACTGGCTGCAC
ATCGACGACCATGTGCAGGGCATCGAGCTGGTGCGCACCAAGGGCCGCCCCGGCGAGGTC
TACAACATCGGCGGCGGCACGGAGCTGTCCAACACGGCCCTGACCGGGCGCCTGCTGGAG
GCGTGCGGCGCGGGCTGGGAGCGGGTCGACCACGTCGCGGACCGCAAGGGCCACGACCGG
CGCTACTCGGTGGACTGGACGAAGATCCGCACCGAGCTGGGGTACGCGCCGCACCGCGAC
TTCGACTCCGCCCTGGCGGAGACCATCGACTGGTACCGCACGCACCGCGAGTGGTGGGAG
CCGCTCAAGCGCCGCGCGGGACTGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001509 NAD-dependent epimerase/dehydratase (Domain)
 [3-244]  4.30000000000003e-64 PF01370
PF01370   Epimerase
IPR005888 dTDP-glucose 4,6-dehydratase (Family)
 [2-322]  2.70000000000002e-125 TIGR01181
TIGR01181   DTDP_gluc_dehyt
IPR016040 NAD(P)-binding domain (Domain)
 [1-191]  5.69999999999998e-61 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP No significant hit
TMHMM No significant hit