close all open/close all

CDS information : Strply_00190


close this sectionLocation

Organism
StrainNRRL 2433 (=NBRC 13058)
Entry nameStreptolydigin
Contig
Start / Stop / Direction24,499 / 23,432 / - [in whole cluster]
24,499 / 23,432 / - [in contig]
Locationcomplement(23432..24499) [in whole cluster]
complement(23432..24499) [in contig]
TypeCDS
Length1,068 bp (355 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative glucose-1-phosphate thymidylyltransferase
putative dTDP-glucose synthase
Product (GenBank)NDP-glucose synthase
Gene
Gene (GenBank)slgS1
EC number2.7.7.24
Keyword
  • L-rhodinose
Note
Note (GenBank)
Reference
ACC
PmId
[19875077] Deciphering biosynthesis of the RNA polymerase inhibitor streptolydigin and generation of glycosylated derivatives. (Chem Biol. , 2009)
Related Reference
ACC
Q194R4
NITE
Mith_00060
PmId
[9150235] Cloning and insertional inactivation of Streptomyces argillaceus genes involved in the earliest steps of biosynthesis of the sugar moieties of the antitumor polyketide mithramycin. (J Bacteriol. , 1997)

close this sectionSequence

selected fasta
>putative glucose-1-phosphate thymidylyltransferase [NDP-glucose synthase]
MRALVLAGGTGTRLRPLTHTSAKQMVPVANKPVLFYGLESIARAGIIDVGIVVGDTAAEI
RAAVGDGSRFGLKVTYIPQHAPLGLAHAVLVARDFLGEEDFLMYLGDNFICGGITGLVAD
FQVKRPDAHILLTRVADPGAFGVAELGPDGRVVGLEEKPEQPRSDLAMVGVYLFTPAVHE
AVRAIEPSRRGELEITHALQWLIDAGRRVDSTLIEDYWKDTGSVVDMLEVNRTVLESAEP
RLDGLVDEHSEIIGRVVVEAGSQIRGSRIVGPVVIGADSRITGSYVGPFTSIGERCRLDD
CEVEYSVVLPETRITGVRRIAASLIGRNVEVSPAAPGPRTHRLVLGDHSTVQIAS
selected fasta
>putative glucose-1-phosphate thymidylyltransferase [NDP-glucose synthase]
ATGAGAGCACTCGTGCTGGCCGGCGGGACCGGGACCAGACTGCGTCCGCTCACCCACACC
TCGGCCAAGCAGATGGTGCCGGTGGCCAACAAGCCCGTGCTGTTCTACGGCCTGGAATCG
ATCGCCCGTGCCGGGATCATCGACGTCGGCATCGTCGTCGGCGACACCGCGGCGGAGATC
CGCGCGGCGGTCGGGGACGGATCGAGATTCGGCCTGAAGGTCACCTACATCCCGCAGCAC
GCGCCGCTCGGCCTGGCCCACGCGGTGCTGGTCGCCCGGGACTTCCTGGGGGAGGAGGAC
TTCCTCATGTACCTCGGCGACAACTTCATCTGCGGCGGGATCACCGGACTCGTGGCGGAC
TTCCAGGTCAAACGGCCCGACGCACACATCCTGCTGACCCGGGTGGCCGACCCCGGCGCC
TTCGGCGTGGCCGAGCTCGGCCCGGACGGGCGGGTCGTGGGGCTGGAGGAGAAGCCGGAG
CAGCCGCGCAGCGACCTCGCCATGGTCGGCGTCTACCTGTTCACCCCGGCCGTCCACGAA
GCGGTGCGGGCCATCGAGCCCTCCCGGCGGGGCGAGCTGGAGATCACCCACGCCCTGCAA
TGGCTGATCGACGCCGGGCGGCGGGTGGACTCCACCCTCATCGAGGACTACTGGAAGGAC
ACCGGTAGCGTGGTGGACATGCTGGAGGTCAACCGCACCGTCCTGGAGAGCGCCGAACCC
AGGCTGGACGGGCTGGTCGACGAGCACAGCGAGATCATCGGCCGGGTCGTGGTCGAGGCC
GGGTCCCAGATCCGCGGCTCACGCATCGTCGGCCCGGTCGTGATCGGCGCGGACAGCCGG
ATCACCGGCTCCTACGTCGGTCCGTTCACCTCCATCGGCGAGCGCTGCCGGCTCGACGAC
TGCGAGGTCGAGTACTCCGTCGTCCTGCCGGAGACCCGCATCACCGGAGTGCGCCGCATC
GCCGCCTCGCTGATCGGACGCAATGTGGAGGTCAGCCCGGCCGCGCCCGGCCCCCGCACC
CACCGCCTCGTCCTCGGCGACCACAGCACCGTGCAGATCGCGTCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005835 Nucleotidyl transferase (Domain)
 [3-236]  1.09999999999999e-55 PF00483
PF00483   NTP_transferase
IPR005908 Glucose-1-phosphate thymidylyltransferase, long form (Family)
 [2-352]  TIGR01208
TIGR01208   RmlA_long
SignalP No significant hit
TMHMM No significant hit