close all open/close all

CDS information : Strply_00200


close this sectionLocation

Organism
StrainNRRL 2433 (=NBRC 13058)
Entry nameStreptolydigin
Contig
Start / Stop / Direction25,845 / 24,496 / - [in whole cluster]
25,845 / 24,496 / - [in contig]
Locationcomplement(24496..25845) [in whole cluster]
complement(24496..25845) [in contig]
TypeCDS
Length1,350 bp (449 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative glutamate mutase E chain
Product (GenBank)glutamate mutase-E chain
Gene
Gene (GenBank)slgE2
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[19875077] Deciphering biosynthesis of the RNA polymerase inhibitor streptolydigin and generation of glycosylated derivatives. (Chem Biol. , 2009)
[21665968] Amino acid precursor supply in the biosynthesis of the RNA polymerase inhibitor streptolydigin by Streptomyces lydicus. (J Bacteriol. , 2011)
Related Reference
ACC
Q7X543
PmId
[12543643] A glutamate mutase is involved in the biosynthesis of the lipopeptide antibiotic friulimicin in Actinoplanes friuliensis. (Antimicrob Agents Chemother. , 2003)

close this sectionSequence

selected fasta
>putative glutamate mutase E chain [glutamate mutase-E chain]
MTVEFRVPSHTAEDGTAGNSTGFGEFVRHRAASGELVVQPRMGFSDPARMRAGLLATRRA
AATTVGTLTVDSYTRVGDLAAARDALRAGIALNGYPLATHPRETTAQVLAGIAADDFPVQ
VRHGSADPGHIFTALTAAGLSATEGGPVSYCLPYGRTPLEKSVDSWARCCEDFAEPRRPG
VRPHLETFGGCMLGQLCPPGQLVALSVLEALFFHRHGVRSISVSYAQQSHPGQDREAVRA
LRVLCARLLPDADVHIVVYAYMGLFPQTADGARALLGEATRLARATGAERLIVKTEAEAD
RIPTVAENVAALEHAARTARRHRAEAPAGADDDSQVHAEAYALIDAVLNAAPDIGRALVQ
AFKRGLLDIPYCLHPDNAGRSRSYLDRDGRLRWADVGSLPLAPLVGAGRSRPVTSGELMS
ALSYVRRTFDGDPYGELRGRPRGKAVEDR
selected fasta
>putative glutamate mutase E chain [glutamate mutase-E chain]
ATGACCGTCGAATTCCGTGTTCCGTCGCACACGGCGGAAGACGGGACGGCCGGTAATTCC
ACCGGCTTCGGCGAGTTCGTACGCCACCGGGCCGCATCCGGCGAACTCGTCGTCCAACCG
CGCATGGGATTCAGCGATCCCGCGCGGATGCGGGCCGGACTGCTGGCCACCCGGCGCGCC
GCGGCCACCACCGTGGGCACCCTCACCGTCGACAGCTACACCCGCGTCGGCGACCTGGCG
GCGGCCCGCGACGCCCTGCGCGCGGGCATCGCGCTCAACGGCTACCCCCTCGCGACGCAC
CCACGGGAGACCACCGCGCAGGTCCTCGCGGGCATCGCGGCCGACGACTTCCCCGTACAG
GTCCGGCACGGCTCGGCTGATCCCGGCCACATCTTCACCGCCCTGACCGCCGCCGGGCTC
TCGGCGACCGAGGGCGGACCGGTCTCCTACTGCCTGCCCTACGGCCGCACGCCGCTGGAG
AAGTCCGTCGACAGCTGGGCGCGGTGCTGCGAGGACTTCGCCGAACCGCGGCGGCCGGGC
GTACGGCCGCACCTGGAGACCTTCGGCGGCTGCATGCTCGGGCAGCTGTGCCCGCCCGGC
CAGCTGGTGGCGCTCAGCGTCCTGGAGGCGCTGTTCTTCCACCGCCACGGCGTGCGCAGC
ATTTCGGTGAGCTACGCCCAGCAGAGCCACCCCGGCCAGGACCGGGAGGCGGTCCGGGCG
CTGCGCGTCCTGTGCGCGCGGCTGCTGCCCGACGCGGACGTGCACATCGTGGTCTACGCC
TACATGGGTCTGTTCCCGCAGACCGCGGACGGCGCCCGGGCGCTGCTCGGCGAGGCCACG
CGGCTGGCCCGGGCCACCGGAGCCGAACGGCTCATCGTCAAGACCGAGGCCGAGGCCGAC
CGCATCCCCACGGTCGCCGAGAACGTCGCCGCGCTGGAACACGCGGCCCGCACCGCCCGC
CGCCACCGCGCGGAGGCCCCGGCCGGCGCCGACGACGACTCCCAGGTGCACGCCGAGGCG
TACGCCCTCATCGACGCGGTGCTCAACGCCGCGCCGGACATCGGCCGGGCCCTGGTGCAG
GCGTTCAAGCGCGGGCTGCTGGACATCCCCTACTGCCTCCACCCGGACAACGCCGGCCGC
AGCCGGAGCTATCTGGACCGCGACGGCCGGCTGCGCTGGGCCGACGTCGGTTCGCTCCCG
CTGGCCCCGCTGGTCGGGGCCGGCCGCAGCCGGCCGGTCACCTCCGGCGAGCTGATGAGT
GCCCTGTCCTATGTGCGCCGCACCTTCGACGGCGACCCGTACGGCGAGCTGCGCGGGCGC
CCGCGCGGAAAGGCGGTCGAAGACCGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006396 Glutamate mutase, E subunit (Family)
 [1-442]  PIRSF001495
PIRSF001495   Met_asp_mut_epsi
 [22-405]  2.39999999999997e-102 PF06368
PF06368   Met_asp_mut_E
IPR014348 Cobalamin (vitamin B12)-dependent enzyme, catalytic subdomain (Domain)
 [20-380]  2.39999999999997e-105 G3DSA:3.20.20.240
G3DSA:3.20.20.240   Cobalamin-dep_enz_cat
IPR016176 Cobalamin (vitamin B12)-dependent enzyme, catalytic (Domain)
 [16-442]  4.50001022902825e-111 SSF51703
SSF51703   Cbl-dep_enz_cat
SignalP No significant hit
TMHMM No significant hit