close all open/close all

CDS information : Strply_00210


close this sectionLocation

Organism
StrainNRRL 2433 (=NBRC 13058)
Entry nameStreptolydigin
Contig
Start / Stop / Direction26,303 / 25,842 / - [in whole cluster]
26,303 / 25,842 / - [in contig]
Locationcomplement(25842..26303) [in whole cluster]
complement(25842..26303) [in contig]
TypeCDS
Length462 bp (153 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative glutamate mutase S chain
Product (GenBank)glutamate mutase S-chain
Gene
Gene (GenBank)slgE1
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[19875077] Deciphering biosynthesis of the RNA polymerase inhibitor streptolydigin and generation of glycosylated derivatives. (Chem Biol. , 2009)
[21665968] Amino acid precursor supply in the biosynthesis of the RNA polymerase inhibitor streptolydigin by Streptomyces lydicus. (J Bacteriol. , 2011)
Related Reference
ACC
Q7X542
PmId
[12543643] A glutamate mutase is involved in the biosynthesis of the lipopeptide antibiotic friulimicin in Actinoplanes friuliensis. (Antimicrob Agents Chemother. , 2003)

close this sectionSequence

selected fasta
>putative glutamate mutase S chain [glutamate mutase S-chain]
MGKAMERACDDARHSGVVIVSSLASDAHTWNLVYLQLLLEEHGFEVVNLGACVPDELLVA
ECLDRAPDMVVISSVNGHGYQDGLRVIAQLRRRPPLARTRMVIGGKLGISGARDGLRADR
LLDAGFDAVFPDGPDAVPEFERYLSHVFERVAS
selected fasta
>putative glutamate mutase S chain [glutamate mutase S-chain]
ATGGGCAAGGCAATGGAGCGCGCATGCGACGACGCACGGCACAGCGGAGTGGTGATCGTC
AGCAGTCTCGCTTCCGACGCCCACACCTGGAACCTCGTCTATCTTCAACTGCTGCTGGAA
GAGCACGGTTTCGAGGTGGTGAATCTCGGTGCCTGCGTACCCGATGAACTGCTCGTCGCC
GAATGCCTGGACCGCGCCCCGGACATGGTGGTCATCAGCAGCGTGAACGGGCACGGATAT
CAGGACGGCCTGCGCGTCATCGCCCAACTGCGCCGGCGCCCGCCGCTCGCCCGGACCCGC
ATGGTGATCGGCGGGAAGCTCGGGATATCCGGAGCGCGGGACGGTCTGCGCGCGGACCGG
CTGCTGGACGCCGGATTTGACGCGGTGTTCCCCGACGGGCCCGACGCCGTACCGGAATTC
GAGCGCTATCTGAGTCATGTCTTCGAACGAGTCGCGTCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006158 Cobalamin (vitamin B12)-binding (Domain)
 [13-150]  5.99999044089058e-22 SSF52242
SSF52242   Cbl-bd
 [15-151]  PS51332
PS51332   B12_BINDING
 [14-146]  8.70000000000003e-18 G3DSA:3.40.50.280
G3DSA:3.40.50.280   B12_bd
 [17-139]  9.7e-14 PF02310
PF02310   B12-binding
SignalP
 [1-29]  0.123 Signal
Eukaryota   
TMHMM No significant hit