close all open/close all

CDS information : Strply_00220


close this sectionLocation

Organism
StrainNRRL 2433 (=NBRC 13058)
Entry nameStreptolydigin
Contig
Start / Stop / Direction26,650 / 28,749 / + [in whole cluster]
26,650 / 28,749 / + [in contig]
Location26650..28749 [in whole cluster]
26650..28749 [in contig]
TypeCDS
Length2,100 bp (699 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)putative ATP/GTP binding-protein
Gene
Gene (GenBank)slgY
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[19875077] Deciphering biosynthesis of the RNA polymerase inhibitor streptolydigin and generation of glycosylated derivatives. (Chem Biol. , 2009)
[22820841] Three pathway-specific regulators control streptolydigin biosynthesis inStreptomyces lydicus. (Microbiology. , 2012)

close this sectionSequence

selected fasta
>hypothetical protein [putative ATP/GTP binding-protein]
MTSYAQDAYTPDSRAGDATGLDDELAEERRYVALCRSAMTRQVEDAGLQVTEGQDVSGDG
ASAEALGRYLRTRARDMAQEPDSPLFFGRLDFDDAPETGDHRRQRYYIGRRRVSEHPAAP
PLVVDWRAPVSRTFYQASALEPQGVAVRRRFGWAPLSSGEPKDLTGMEDEHLDRQEDVPA
GASRIVAAEIERPRTGPMRDIAATIQPEQDDLVRRELADSVCIQGAPGSGKTAVGLHRAA
YLLYTYPQRLQRSGLLIIGPNQTFLRYIAQVLPALGEIDIAQCTVEDVVARHPVQAVDGE
LAAAVKQSHRMAAVLERALYSRVTAVPDGITVPDGSYRWRVYGDELSRIVEEVREQAPPY
AVGREHVRSRAVSLVQEQAERRAGPKNMTWQRKIGRCRPVAAFLDAVWPTVRAEEVVAGL
LGDAEALARAADGLLDADEQAALVWDRPPRSVKSAKWSVQDMLLIDEVAGLIERPGSFGH
VVVDEAQDLSPMQCRAIARRSGFGSLTVLGDLAQATAPWAARSWAEQLAHLGKTQGTVTE
LTTGFRVPAAVMSLANRLLGALDVDVPPARSLRQDGELSVRRVPDTLSATVEAARQALTQ
EGAIAVITADAEAERTAEALRAAGLEVATSEDVGTAARLAVLPAKVVKGLEYDHVIVVEP
SAIVAAEPRGLHRLYVAVTRAVSRLDVLHAHPLPEPLAG
selected fasta
>hypothetical protein [putative ATP/GTP binding-protein]
ATGACGTCATACGCCCAGGACGCGTACACCCCGGACTCCCGCGCCGGCGATGCCACCGGG
CTGGACGACGAACTCGCCGAGGAGCGGCGGTACGTCGCCCTGTGCCGGAGCGCGATGACC
CGGCAGGTGGAGGACGCGGGCCTGCAGGTCACCGAGGGGCAGGACGTCTCGGGCGACGGC
GCGAGCGCGGAGGCGCTGGGCCGGTATCTGCGCACCCGCGCACGGGACATGGCGCAGGAG
CCGGACAGCCCGCTCTTCTTCGGCCGGCTGGACTTCGACGACGCGCCGGAGACCGGGGAC
CACCGCCGGCAGCGCTACTACATCGGGCGCCGCCGGGTCTCGGAGCACCCGGCCGCGCCG
CCGCTGGTCGTCGACTGGCGGGCGCCGGTCTCGCGCACCTTCTATCAGGCGAGCGCCCTG
GAACCGCAGGGCGTCGCGGTCCGCCGGCGCTTCGGCTGGGCACCGCTGAGCAGCGGCGAG
CCGAAGGACCTGACGGGCATGGAGGACGAGCACCTCGACCGGCAGGAGGACGTGCCGGCC
GGGGCGAGCCGGATCGTCGCGGCCGAGATCGAGCGCCCGCGCACCGGCCCGATGCGCGAC
ATCGCCGCCACCATCCAGCCGGAGCAGGACGACCTGGTGCGCCGCGAACTGGCCGATTCG
GTGTGCATCCAGGGGGCACCGGGCAGCGGAAAGACCGCGGTCGGTCTGCACCGTGCGGCC
TACCTGCTGTACACCTACCCGCAGCGGCTGCAGCGCAGCGGTCTGCTGATCATCGGCCCC
AACCAGACGTTCCTGCGCTACATCGCCCAGGTGCTCCCGGCGCTCGGCGAGATCGACATC
GCGCAGTGCACGGTGGAGGACGTGGTGGCCCGCCATCCGGTGCAGGCCGTCGACGGCGAA
CTGGCGGCGGCCGTCAAGCAGAGCCACCGGATGGCGGCCGTACTGGAGCGCGCCCTGTAC
AGCAGGGTCACCGCGGTCCCCGACGGCATCACCGTCCCGGACGGCTCCTACCGCTGGCGG
GTGTACGGCGACGAGTTGAGCCGCATCGTCGAGGAGGTCCGCGAGCAGGCGCCGCCGTAC
GCGGTGGGGCGCGAACACGTCCGCTCGCGGGCGGTGTCGCTGGTGCAGGAGCAGGCCGAG
CGCCGGGCGGGCCCCAAGAACATGACCTGGCAGCGGAAGATCGGCCGCTGCCGCCCGGTC
GCGGCCTTCCTGGACGCCGTGTGGCCCACGGTCCGGGCGGAGGAGGTGGTCGCCGGTCTG
CTGGGCGATGCCGAGGCGCTGGCCCGGGCGGCGGACGGGCTGCTGGACGCGGACGAGCAG
GCGGCGCTGGTGTGGGACAGGCCGCCGCGATCGGTCAAGAGCGCCAAGTGGTCCGTCCAG
GACATGCTGTTGATCGACGAGGTAGCCGGCCTGATCGAGCGGCCCGGCAGCTTCGGCCAT
GTGGTCGTCGACGAGGCCCAGGACCTCTCCCCCATGCAGTGCCGGGCGATCGCCCGCCGC
AGCGGCTTCGGTTCGCTCACCGTACTGGGTGACCTGGCACAGGCCACCGCTCCGTGGGCG
GCGCGCTCCTGGGCCGAGCAGCTGGCGCATCTGGGCAAGACCCAGGGGACGGTCACCGAG
CTCACCACCGGCTTCCGGGTGCCGGCCGCCGTGATGTCCCTGGCCAACCGGCTGCTGGGC
GCGCTCGACGTGGACGTGCCGCCGGCCCGGTCCCTGCGCCAGGACGGCGAGTTGTCGGTC
CGCCGGGTACCGGACACGCTGTCCGCGACGGTCGAGGCCGCGCGGCAGGCGCTGACGCAG
GAGGGGGCCATCGCGGTGATCACCGCGGACGCCGAGGCGGAGCGGACGGCCGAGGCGCTG
CGGGCGGCGGGCCTGGAGGTCGCCACCTCCGAGGACGTCGGTACGGCGGCGCGGCTCGCG
GTCCTGCCGGCGAAGGTCGTCAAGGGCCTGGAGTACGACCACGTGATCGTCGTGGAGCCG
TCGGCCATCGTGGCGGCCGAGCCGCGCGGTCTGCACCGGTTGTACGTGGCCGTGACGCGT
GCGGTGTCCCGCCTCGACGTGCTGCACGCGCACCCGCTGCCGGAGCCGCTGGCCGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR014016 UvrD-like Helicase, ATP-binding domain (Domain)
 [204-548]  PS51198
PS51198   UVRD_HELICASE_ATP_BIND
SignalP No significant hit
TMHMM No significant hit