close all open/close all

CDS information : Strply_00230


close this sectionLocation

Organism
StrainNRRL 2433 (=NBRC 13058)
Entry nameStreptolydigin
Contig
Start / Stop / Direction29,524 / 28,862 / - [in whole cluster]
29,524 / 28,862 / - [in contig]
Locationcomplement(28862..29524) [in whole cluster]
complement(28862..29524) [in contig]
TypeCDS
Length663 bp (220 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
ProductTetR family transcriptional regulator
Product (GenBank)TetR-family transcriptional regulator
Gene
Gene (GenBank)slgR1
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[19875077] Deciphering biosynthesis of the RNA polymerase inhibitor streptolydigin and generation of glycosylated derivatives. (Chem Biol. , 2009)
[22820841] Three pathway-specific regulators control streptolydigin biosynthesis inStreptomyces lydicus. (Microbiology. , 2012)
Related Reference
ACC
P39885
PmId
[1592820] The Streptomyces glaucescens TcmR protein represses transcription of the divergently oriented tcmR and tcmA genes by binding to an intergenic operator region. (J Bacteriol. , 1992)

close this sectionSequence

selected fasta
>TetR family transcriptional regulator [TetR-family transcriptional regulator]
MEERDEPMGLRERKKQRTRQAISDAAISLFLQHGFDQVSVVDVAAAAEVSKPTLFKYFPT
KEDLVVHRFADHETVAGTIVRERRSGVSPLAALHQHFVDGLARRDPITGLNDEQEVLDFH
GLVYSTPSLLTRVVQYQSRAEEALAQALAEALDAGPADVTPRLLAGQVVAAQRILAAANW
QRIVDGATADGSYPQAVADADHAFALLEWGLAGPSAARTA
selected fasta
>TetR family transcriptional regulator [TetR-family transcriptional regulator]
GTGGAAGAGCGAGACGAGCCGATGGGGCTCAGGGAGCGCAAGAAACAGCGGACGCGGCAG
GCGATCTCCGACGCCGCGATCTCACTGTTCCTCCAGCACGGGTTCGACCAGGTCTCGGTC
GTGGACGTGGCGGCGGCGGCCGAGGTGTCCAAGCCGACGCTGTTCAAGTACTTCCCGACC
AAGGAAGACCTGGTGGTGCACCGCTTCGCCGACCACGAGACGGTGGCGGGCACCATCGTG
CGCGAGCGCCGCTCCGGCGTCTCACCGCTCGCCGCCCTGCACCAGCACTTCGTCGACGGG
CTGGCCCGCCGCGACCCCATCACGGGCCTGAACGACGAGCAGGAGGTCCTCGACTTCCAC
GGTCTGGTGTACTCCACGCCCAGCCTGCTCACCCGCGTGGTGCAGTACCAGAGCCGCGCC
GAGGAAGCGCTGGCGCAGGCGCTGGCCGAGGCACTGGACGCCGGGCCCGCCGACGTCACG
CCCCGGCTGCTGGCCGGTCAGGTCGTCGCCGCCCAGCGCATCCTGGCCGCGGCCAACTGG
CAGCGGATCGTCGACGGCGCCACGGCGGACGGCAGTTACCCGCAGGCGGTCGCCGACGCC
GACCATGCCTTCGCGCTGCTGGAGTGGGGACTCGCCGGCCCCTCGGCAGCCCGCACCGCC
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001647 DNA-binding HTH domain, TetR-type (Domain)
 [23-65]  1.4e-14 PF00440
PF00440   TetR_N
 [22-35]  1.30000067202732e-08 PR00455 [43-66]  1.30000067202732e-08 PR00455
PR00455   HTHTETR
 [16-76]  PS50977
PS50977   HTH_TETR_2
IPR009057 Homeodomain-like (Domain)
 [6-94]  1.10000150671642e-17 SSF46689
SSF46689   Homeodomain_like
 [10-63]  2.2e-21 G3DSA:1.10.10.60
G3DSA:1.10.10.60   Homeodomain-rel
IPR015893 Tetracycline transcriptional regulator, TetR-like, C-terminal (Domain)
 [64-211]  2e-15 G3DSA:1.10.357.10
G3DSA:1.10.357.10   TetR_C
IPR023772 DNA-binding HTH domain, TetR-type, conserved site (Conserved_site)
 [34-65]  PS01081
PS01081   HTH_TETR_1
SignalP No significant hit
TMHMM No significant hit