close all open/close all

CDS information : Strply_00240


close this sectionLocation

Organism
StrainNRRL 2433 (=NBRC 13058)
Entry nameStreptolydigin
Contig
Start / Stop / Direction29,625 / 31,172 / + [in whole cluster]
29,625 / 31,172 / + [in contig]
Location29625..31172 [in whole cluster]
29625..31172 [in contig]
TypeCDS
Length1,548 bp (515 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative drug resistance transporter
Product (GenBank)putative transport integral membrain protein
Gene
Gene (GenBank)slgT
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[19875077] Deciphering biosynthesis of the RNA polymerase inhibitor streptolydigin and generation of glycosylated derivatives. (Chem Biol. , 2009)
Related Reference
ACC
P42670
PmId
[7916693] The pur8 gene from the pur cluster of Streptomyces alboniger encodes a highly hydrophobic polypeptide which confers resistance to puromycin. (Eur J Biochem. , 1993)

close this sectionSequence

selected fasta
>putative drug resistance transporter [putative transport integral membrain protein]
MPRRPASTSAERRKRSDMTQATAASTTRQARFRWWGLAVIGIAQLMVMLDTTIVNIALPW
AQRATGMSDADRQWVITAYTLAFGGLLLLGGRIGDLIGRKRAFVIAVAGFTAASAAGGAA
PTAAILVGSRAAQGLFAALLIPATLAMLTTTFTEPRERAKAFGVFSSVAAAGGALGLLCG
GVITQYLDWRWCLYVNVPIGVLVAVGAWLLLPGLPAQRGVRIDVPGAVLSSGGMVALVYG
FSEAADEGWGSGRVVGLLVAALVLLTAFVALQAKVRDPLLPLRVLAERNRAGGFLTIALA
MVGMFGLFLIMTYQLQVVMHYSPARAGLALLPATLATVLTTTQVTARLMPRVPVRLLVAP
GLLLAAAGLFNLGRLTPESPYASTLLPTQILLGAGLGLVMTPCVNIATNKVPPADVGVVS
AFVSTSQQIGGSIGTALLNTIATSVTATALASRAPGAAATAEATVHGYAVASLWAGGILL
VTAVVAAVLIKVDLRTPAPAKAPAAPAKEEVAPGT
selected fasta
>putative drug resistance transporter [putative transport integral membrain protein]
GTGCCGCGCCGGCCTGCGTCAACGAGCGCGGAAAGACGAAAGAGGAGCGACATGACGCAA
GCGACCGCGGCCTCGACCACGAGGCAGGCGCGCTTCCGGTGGTGGGGCCTGGCGGTGATC
GGGATCGCCCAGCTGATGGTCATGCTGGACACCACGATCGTGAACATCGCCCTTCCCTGG
GCGCAGCGGGCCACGGGCATGTCGGACGCGGACCGGCAATGGGTGATCACCGCCTACACC
CTCGCCTTCGGCGGACTGCTGCTCCTGGGCGGCCGGATCGGCGACCTCATCGGGCGCAAG
CGGGCCTTCGTCATCGCGGTCGCCGGATTCACCGCCGCCTCCGCGGCCGGCGGCGCCGCG
CCGACCGCCGCGATCCTGGTCGGCTCCCGCGCCGCACAGGGACTCTTCGCCGCGCTCCTG
ATCCCCGCGACCCTCGCGATGCTCACCACGACGTTCACCGAGCCCCGGGAGCGCGCCAAG
GCGTTCGGCGTCTTCAGCTCGGTGGCCGCGGCCGGCGGAGCGCTGGGTCTGCTCTGCGGC
GGCGTGATCACCCAATACCTCGACTGGCGCTGGTGCCTGTACGTCAACGTCCCCATCGGG
GTCCTGGTGGCCGTCGGCGCCTGGCTGCTGCTGCCCGGTCTGCCGGCCCAGCGGGGCGTG
CGGATCGACGTCCCCGGCGCGGTGCTCTCCAGCGGCGGCATGGTGGCGCTGGTCTACGGC
TTCAGCGAGGCCGCGGACGAGGGCTGGGGCTCGGGCCGGGTGGTCGGCCTGCTGGTGGCC
GCGCTGGTGCTGCTGACCGCCTTCGTGGCGCTCCAGGCCAAGGTCCGCGATCCCCTGCTG
CCGCTGCGGGTGCTGGCCGAACGCAACCGCGCCGGCGGCTTCCTCACCATCGCGCTGGCC
ATGGTCGGCATGTTCGGGCTGTTCCTGATCATGACCTACCAGCTCCAGGTGGTCATGCAC
TACTCACCGGCCCGTGCCGGGCTGGCGCTGCTCCCGGCGACCCTGGCGACGGTGCTCACC
ACGACCCAGGTCACCGCCCGGCTCATGCCGCGGGTGCCGGTGCGGCTGCTGGTGGCGCCG
GGCCTGCTGCTGGCCGCGGCCGGACTGTTCAACCTCGGCCGGCTGACCCCGGAGAGCCCG
TACGCGTCGACGCTGCTGCCCACCCAGATCCTGCTCGGCGCCGGACTGGGCCTGGTGATG
ACGCCGTGCGTCAACATCGCGACGAACAAGGTGCCGCCCGCCGACGTCGGTGTCGTCTCG
GCGTTCGTCAGCACCTCGCAGCAGATCGGCGGCTCCATCGGGACGGCGCTGCTCAACACC
ATCGCGACGAGCGTGACGGCCACCGCCCTGGCCTCCCGGGCGCCCGGAGCCGCGGCCACC
GCGGAGGCGACCGTGCACGGCTACGCGGTGGCGAGCCTGTGGGCCGGCGGGATCCTGCTG
GTCACCGCGGTCGTCGCGGCGGTCCTGATCAAGGTCGACCTGCGGACGCCGGCTCCGGCC
AAGGCGCCGGCCGCGCCCGCCAAGGAGGAAGTCGCCCCGGGCACCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004638 Drug resistance transporter EmrB/QacA subfamily (Family)
 [39-448]  2.59999999999995e-76 TIGR00711
TIGR00711   Efflux_EmrB
IPR011701 Major facilitator superfamily (Family)
 [41-435]  1.99999999999999e-45 PF07690
PF07690   MFS_1
IPR016196 Major facilitator superfamily domain, general substrate transporter (Domain)
 [1-499]  1.59998835313644e-67 SSF103473
SSF103473   MFS_gen_substrate_transporter
IPR020846 Major facilitator superfamily domain (Domain)
 [36-495]  PS50850
PS50850   MFS
SignalP
 [1-1]  Signal-anchor
Eukaryota   
TMHMM
 [32-54]  Transmembrane (i-o) [74-96]  Transmembrane (o-i) [103-125]  Transmembrane (i-o) [130-152]  Transmembrane (o-i) [164-186]  Transmembrane (i-o) [191-213]  Transmembrane (o-i) [226-245]  Transmembrane (i-o) [249-271]  Transmembrane (o-i) [291-313]  Transmembrane (i-o) [317-339]  Transmembrane (o-i) [352-370]  Transmembrane (i-o) [385-407]  Transmembrane (o-i) [428-450]  Transmembrane (i-o) [470-492]  Transmembrane (o-i)
Transmembrane 14