close all open/close all

CDS information : Strply_00250


close this sectionLocation

Organism
StrainNRRL 2433 (=NBRC 13058)
Entry nameStreptolydigin
Contig
Start / Stop / Direction31,294 / 32,538 / + [in whole cluster]
31,294 / 32,538 / + [in contig]
Location31294..32538 [in whole cluster]
31294..32538 [in contig]
TypeCDS
Length1,245 bp (414 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative cytochrome P450
Product (GenBank)cytochrome P450
Gene
Gene (GenBank)slgO1
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[19875077] Deciphering biosynthesis of the RNA polymerase inhibitor streptolydigin and generation of glycosylated derivatives. (Chem Biol. , 2009)
[22569159] Novel compounds produced by Streptomyces lydicus NRRL 2433 engineered mutants altered in the biosynthesis of streptolydigin. (J Antibiot (Tokyo). , 2012)
Related Reference
ACC
P33271
PmId
[1732208] Characterization of Saccharopolyspora erythraea cytochrome P-450 genes and enzymes, including 6-deoxyerythronolide B hydroxylase. (J Bacteriol. , 1992)

close this sectionSequence

selected fasta
>putative cytochrome P450 [cytochrome P450]
MSENPVRSRLRQLDAAFMQDPHSLYAELHGDGPAHQVVLPPDLPVCGGLPVWVVTGYDAV
RAALTDPRLSTDLRRTDPLFAQNAPDSDKRGAFSASLATHMLHSDPPDHTRLRRLVNSVF
TTRAVERFRPDIERLTHQLLDGLPDEGVVDLLDRFAFPLPIAVICLLLGIPPGEEAAFST
WSRALVAGGTSEAAAAASAELTGYLRDLIERKRRAPSGDVLSTLVAARDDEDRLSETELL
SMTFLLLVAGHETTVNTLGNGVFHLMADRDQWEKLLADRSLLPTAVEEFLRIEGPLKHAT
FRCATECVRIGDVDIPAGDFVLLSLASANRDPRRFTRPHDLDVSRATGGHLAFGHGIHHC
LGAPLARLEARIAFDALLQRFPGMELAVAPGELRWRSSTLIRGLRTLPVRLHRA
selected fasta
>putative cytochrome P450 [cytochrome P450]
ATGTCAGAGAACCCGGTCCGCTCACGCCTCCGGCAGCTCGACGCCGCCTTCATGCAGGAC
CCGCATTCCCTCTACGCCGAACTGCACGGCGACGGCCCGGCCCACCAGGTCGTCCTCCCG
CCGGACCTCCCGGTCTGCGGCGGCCTGCCGGTGTGGGTCGTGACCGGCTACGACGCGGTG
CGCGCGGCGCTCACGGACCCCCGGCTCAGCACCGATCTGCGCAGGACGGACCCGCTCTTC
GCGCAGAACGCACCGGACAGCGACAAGCGCGGCGCCTTCTCCGCCTCCCTCGCCACGCAC
ATGCTGCACAGCGACCCACCGGACCACACCAGGCTCCGCCGGCTCGTCAACAGCGTGTTC
ACCACCCGCGCCGTCGAGCGGTTCCGCCCCGACATCGAGCGCCTCACCCATCAACTGCTG
GACGGTCTGCCCGACGAGGGCGTCGTGGACCTCCTGGACCGCTTCGCGTTTCCGCTGCCG
ATCGCGGTGATCTGCCTGCTGCTGGGGATACCGCCCGGGGAGGAGGCAGCCTTCAGTACC
TGGTCCAGGGCGCTGGTCGCCGGTGGCACCTCGGAAGCGGCCGCCGCCGCATCGGCCGAA
CTGACCGGCTATCTGCGCGACCTCATCGAGCGCAAGCGCCGCGCACCGTCCGGCGATGTG
CTGTCCACGCTGGTGGCCGCCCGCGACGACGAGGACCGGCTGAGCGAGACCGAGCTGCTG
TCGATGACGTTTCTGCTGCTGGTCGCCGGCCACGAGACCACCGTCAACACCCTGGGCAAC
GGGGTGTTCCATCTGATGGCGGACCGCGACCAGTGGGAGAAGCTGCTCGCCGACCGGTCG
CTGCTGCCCACCGCGGTGGAGGAATTCCTGCGAATCGAGGGGCCGTTGAAGCACGCCACG
TTCCGCTGCGCCACGGAGTGCGTACGCATCGGTGACGTGGACATCCCCGCCGGGGACTTC
GTGCTGCTGTCGCTGGCCTCCGCCAACCGCGACCCGCGGCGGTTCACCCGGCCGCACGAC
CTGGACGTCTCCCGCGCGACCGGCGGCCACCTGGCGTTCGGGCACGGCATCCACCACTGC
CTGGGCGCGCCGCTGGCCCGGCTGGAGGCCCGGATCGCCTTCGACGCGCTGCTCCAGCGG
TTCCCCGGCATGGAACTGGCCGTCGCACCGGGCGAGTTGCGCTGGCGGTCCAGCACGCTC
ATCCGCGGCCTCCGCACGCTCCCGGTCCGTCTGCACCGCGCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [196-381]  2.5e-22 PF00067
PF00067   p450
 [249-266]  1.30000067202732e-05 PR00385 [284-295]  1.30000067202732e-05 PR00385 [351-360]  1.30000067202732e-05 PR00385 [360-371]  1.30000067202732e-05 PR00385
PR00385   P450
 [5-413]  6.10002656149838e-104 SSF48264
SSF48264   Cytochrome_P450
 [4-412]  5.50000000000008e-118 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
IPR002397 Cytochrome P450, B-class (Family)
 [104-115]  3.39999972437719e-53 PR00359 [150-166]  3.39999972437719e-53 PR00359 [167-182]  3.39999972437719e-53 PR00359 [203-225]  3.39999972437719e-53 PR00359 [284-295]  3.39999972437719e-53 PR00359 [302-329]  3.39999972437719e-53 PR00359 [330-345]  3.39999972437719e-53 PR00359 [351-360]  3.39999972437719e-53 PR00359 [360-371]  3.39999972437719e-53 PR00359
PR00359   BP450
IPR017972 Cytochrome P450, conserved site (Conserved_site)
 [353-362]  PS00086
PS00086   CYTOCHROME_P450
SignalP
 [1-26]  0.29 Signal
Bacteria, Gram-negative   
TMHMM No significant hit