close all open/close all

CDS information : Strply_00260


close this sectionLocation

Organism
StrainNRRL 2433 (=NBRC 13058)
Entry nameStreptolydigin
Contig
Start / Stop / Direction34,136 / 32,589 / - [in whole cluster]
34,136 / 32,589 / - [in contig]
Locationcomplement(32589..34136) [in whole cluster]
complement(32589..34136) [in contig]
TypeCDS
Length1,548 bp (515 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)putative ent-copalyl diphosphate synthase
Gene
Gene (GenBank)slgX
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[19875077] Deciphering biosynthesis of the RNA polymerase inhibitor streptolydigin and generation of glycosylated derivatives. (Chem Biol. , 2009)
Related Reference
ACC
Q5KSN5
PmId
[15712669] Presence of copalyl diphosphate synthase gene in an actinomycete possessing the mevalonate pathway. (J Antibiot (Tokyo). , 2004)

close this sectionSequence

selected fasta
>hypothetical protein [putative ent-copalyl diphosphate synthase]
MNQPTAQDLHPLITALVHDVRRDPTGALGPSVYETARLTALAPWLPGHAARIAFLLDEQN
PDGSWAGPDGYALVPTLSAVQALLALLGRDGSAALPVPREAVASAAVRGLTAAAAVLAKS
EQCAVPPTVVYFMIIPALVEDINARLAAPPPGLPGTALRPLPLPHGMTDAVLRSLRTDAW
RNPLAGHYLEIVGPVAVNAREMQPVDGAVGCSAAATAAWLGPDEPTDPDHPSVRFLTATQ
ARLGGPVPAMTSLTYYERAWILGNLATAGAPVELLAPLAEGLPPDVGRSGAPTAPGFAYE
AETSAIVLTALAHLDAPEEPHYLWQYDAGSHFMSTLPEHQPSNTTNAHVLEALGGYAEQH
PADAARYRDAVTRIARWLGERQQPDGSWSDKWHASPLFATARCVLALHRHAGAQSAETVR
RAVRWVLRNQHDDGSWGHWGGTAEETAYAVRILLDTRAEGDQEAVRAALRGRDHLLRHGP
GDRHPPLWIGKELYTPAHIVRAAVLGALLAAQRLD
selected fasta
>hypothetical protein [putative ent-copalyl diphosphate synthase]
GTGAACCAGCCCACCGCACAGGACCTCCATCCGCTGATCACCGCGCTGGTGCACGACGTC
CGCCGGGATCCGACGGGCGCGCTGGGCCCCTCCGTCTACGAGACGGCCCGGCTGACCGCG
CTGGCCCCCTGGCTCCCGGGCCACGCGGCGCGGATCGCCTTCCTCCTCGACGAGCAGAAC
CCGGACGGCAGTTGGGCCGGCCCGGACGGCTATGCGCTGGTCCCCACCCTGAGCGCGGTG
CAGGCCCTGCTGGCCCTCCTCGGCCGGGACGGCTCCGCGGCGTTGCCCGTCCCGAGGGAG
GCCGTCGCCTCCGCCGCCGTACGGGGACTGACCGCCGCGGCCGCGGTACTCGCCAAGAGC
GAGCAGTGCGCGGTGCCGCCCACGGTCGTTTACTTCATGATCATTCCGGCCCTGGTGGAG
GACATCAACGCACGGTTGGCCGCCCCGCCGCCCGGCCTCCCCGGCACCGCCCTGCGCCCG
CTGCCGCTGCCGCACGGCATGACCGACGCCGTACTGCGCAGCCTGCGGACGGACGCCTGG
CGCAACCCGCTGGCCGGCCACTACCTGGAGATCGTCGGGCCGGTCGCGGTCAACGCCCGC
GAAATGCAGCCCGTCGACGGGGCCGTGGGCTGCTCGGCCGCGGCGACCGCGGCCTGGCTC
GGCCCCGACGAACCCACCGACCCGGACCACCCCTCGGTGCGCTTCCTCACCGCCACCCAG
GCCCGGCTCGGCGGACCGGTCCCCGCCATGACCTCGCTGACGTACTACGAACGGGCCTGG
ATCCTGGGCAACCTCGCCACCGCGGGCGCCCCCGTCGAGCTGCTCGCGCCGCTGGCGGAG
GGACTGCCGCCCGACGTCGGACGCTCGGGCGCGCCCACCGCACCGGGGTTCGCCTACGAG
GCCGAGACCAGCGCCATCGTCCTGACGGCGCTCGCCCACCTGGACGCCCCGGAAGAACCC
CACTACCTGTGGCAGTACGACGCGGGCAGCCACTTCATGTCCACCCTCCCGGAACACCAG
CCCTCGAACACCACCAACGCCCACGTCCTCGAAGCGCTCGGCGGCTACGCCGAGCAGCAC
CCCGCCGACGCCGCCCGCTACCGCGACGCGGTCACCCGGATCGCCCGCTGGCTGGGGGAG
CGGCAGCAGCCGGACGGCAGCTGGTCGGACAAGTGGCATGCCTCCCCGCTCTTCGCCACC
GCGCGCTGCGTCCTCGCCCTGCACCGGCATGCCGGCGCGCAGTCCGCCGAAACGGTGCGG
CGGGCCGTCCGCTGGGTGCTGCGCAACCAGCACGACGACGGATCGTGGGGCCACTGGGGC
GGCACCGCGGAGGAGACCGCGTACGCGGTGCGGATCCTCCTGGACACCCGGGCCGAGGGG
GACCAGGAGGCCGTGCGCGCCGCGCTGCGCGGCCGCGACCACCTCCTGCGGCACGGTCCG
GGCGACCGTCATCCGCCCCTGTGGATCGGCAAGGAGCTCTACACCCCCGCCCACATCGTC
CGCGCCGCCGTCCTGGGCGCACTGCTGGCCGCACAGCGGCTCGACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR008930 Terpenoid cyclases/protein prenyltransferase alpha-alpha toroid (Domain)
 [222-470]  2.9000035467798e-29 SSF48239
SSF48239   Terp_cyc_toroid
SignalP No significant hit
TMHMM No significant hit