close all open/close all

CDS information : Strply_00270


close this sectionLocation

Organism
StrainNRRL 2433 (=NBRC 13058)
Entry nameStreptolydigin
Contig
Start / Stop / Direction35,035 / 34,133 / - [in whole cluster]
35,035 / 34,133 / - [in contig]
Locationcomplement(34133..35035) [in whole cluster]
complement(34133..35035) [in contig]
TypeCDS
Length903 bp (300 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative glycosidase
Product (GenBank)putative secreted hydrolase
Gene
Gene (GenBank)slgC1
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[19875077] Deciphering biosynthesis of the RNA polymerase inhibitor streptolydigin and generation of glycosylated derivatives. (Chem Biol. , 2009)
[22726958] Participation of putative glycoside hydrolases SlgC1 and SlgC2 in the biosynthesis of streptolydigin in Streptomyces lydicus. (Microb Biotechnol. , 2012)
Related Reference
ACC
Q2V0H0
PmId
[16601914] Molecular identification of a novel beta-1,3-glucanase from alkaliphilic Nocardiopsis sp. strain F96. (Extremophiles. , 2006)

close this sectionSequence

selected fasta
>putative glycosidase [putative secreted hydrolase]
MTTVDGPRPAPGKDFMSERTAHRPPPAPDRWRVIWQDTFDGDAGAPPDPERWRAVTGSPF
GAGVEEHTDDPGHLALDGDGHLRLTATYEAGTGPDGTEGRYRAAWIETRREDFVPRPGGA
LRIEARVRTAPGSGLDCAMWAWGTQLRHRGDEDPVQAWYRAGEIDVFEVLGSEPDSVWGA
VHSPECHQIPSLGMGGPTTTGDGSALSDRFHTYAVVWRRDPDSLTWSLDGREYLRLIPED
TTPQGWLFHQPVFFCLAVIIGSPGGPVLPGTPDPSAFPSALLVDHLTISEETEPTEGTRA
selected fasta
>putative glycosidase [putative secreted hydrolase]
ATGACGACCGTCGACGGCCCCCGTCCGGCACCCGGAAAGGACTTCATGAGCGAGCGCACC
GCGCACCGGCCCCCACCTGCCCCGGACCGCTGGCGGGTCATCTGGCAGGACACCTTCGAC
GGGGACGCGGGCGCGCCCCCGGACCCGGAGCGCTGGCGGGCCGTCACCGGCAGCCCCTTC
GGCGCCGGCGTGGAGGAGCACACCGACGACCCCGGGCACCTGGCGCTCGACGGCGACGGG
CACCTGCGCCTGACCGCCACGTACGAGGCCGGGACCGGACCCGACGGCACCGAGGGCCGG
TACCGGGCGGCGTGGATCGAGACCCGGCGGGAGGACTTCGTTCCCCGCCCGGGCGGCGCG
CTGCGCATCGAGGCCCGGGTCCGCACCGCCCCCGGCAGCGGCCTCGACTGCGCGATGTGG
GCCTGGGGCACCCAGCTGCGCCACCGTGGGGACGAGGACCCGGTCCAGGCGTGGTACCGG
GCCGGCGAGATCGACGTGTTCGAGGTGCTCGGCTCCGAACCCGACTCCGTCTGGGGCGCG
GTGCACTCCCCGGAGTGCCACCAGATCCCCTCCCTCGGCATGGGCGGCCCCACCACCACC
GGCGACGGCAGCGCGCTCAGCGACCGGTTCCACACCTACGCGGTCGTCTGGCGGCGGGAC
CCCGACTCCCTCACCTGGTCCCTCGACGGCCGTGAGTACCTGCGGCTGATACCCGAGGAC
ACCACGCCCCAGGGATGGCTGTTCCACCAGCCCGTCTTCTTCTGCCTGGCCGTCATCATC
GGCAGCCCGGGCGGACCCGTGCTGCCGGGCACACCGGACCCGTCCGCGTTCCCGTCCGCG
CTGCTCGTCGACCACCTCACCATCTCCGAAGAGACCGAACCGACCGAGGGGACACGGGCG
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000757 Glycoside hydrolase, family 16 (Domain)
 [122-252]  1.2e-13 PF00722
PF00722   Glyco_hydro_16
IPR008985 Concanavalin A-like lectin/glucanase (Domain)
 [20-296]  1.70000295590053e-34 SSF49899
SSF49899   ConA_like_lec_gl
IPR013320 Concanavalin A-like lectin/glucanase, subgroup (Domain)
 [24-288]  9.60000000000003e-37 G3DSA:2.60.120.200
G3DSA:2.60.120.200   ConA_like_subgrp
SignalP No significant hit
TMHMM No significant hit