close all open/close all

CDS information : Strply_00280


close this sectionLocation

Organism
StrainNRRL 2433 (=NBRC 13058)
Entry nameStreptolydigin
Contig
Start / Stop / Direction35,814 / 35,032 / - [in whole cluster]
35,814 / 35,032 / - [in contig]
Locationcomplement(35032..35814) [in whole cluster]
complement(35032..35814) [in contig]
TypeCDS
Length783 bp (260 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productputative type II thioesterase
Product (GenBank)thioesterase type II
Gene
Gene (GenBank)slgB
EC number
Keyword
  • type II thioesterase
Note
Note (GenBank)
Reference
ACC
PmId
[19875077] Deciphering biosynthesis of the RNA polymerase inhibitor streptolydigin and generation of glycosylated derivatives. (Chem Biol. , 2009)
Related Reference
ACC
Q45TR5
PmId
[17159238] Functional analysis of type II thioesterase of Streptomyces lydicus AS 4.2501. (Appl Biochem Biotechnol. , 2006)

close this sectionSequence

selected fasta
>putative type II thioesterase [thioesterase type II]
MTTSATASAIHRANPWIHRYHPAPDGALTLVCFPHAGGSATFYHPVSRALSPQVEVVAVQ
YPGRQERYGEPAIDNLAELADRAHEALAPLAGRPLALFGHSMGAIVAFEVARRMERDAGA
GPLALFLSGRRAPSCRRGDRVSDGGDAALIRELRLLRGTDPAMLDDPEIVEMILPALRAD
YRAIESHRCPPDAAVRCPVTVLTGDADPHTTVEEARAWSGHTTGGCDIEIFPGGHFFLAD
RSADVLAAVARRLRTLAATA
selected fasta
>putative type II thioesterase [thioesterase type II]
ATGACCACCTCCGCGACGGCATCCGCGATCCACCGCGCCAACCCCTGGATCCATCGCTAC
CACCCGGCTCCGGACGGCGCGCTGACCCTGGTCTGCTTCCCGCACGCCGGGGGCTCGGCC
ACCTTCTACCACCCGGTCTCCCGCGCGCTGTCCCCGCAGGTGGAGGTGGTGGCCGTGCAG
TACCCGGGACGTCAGGAGCGGTACGGCGAACCGGCGATCGACAACCTCGCGGAACTCGCC
GACCGCGCCCACGAGGCGCTCGCGCCGCTGGCCGGCCGTCCGCTCGCACTGTTCGGCCAC
AGCATGGGCGCGATCGTCGCCTTCGAGGTGGCCCGGCGGATGGAGCGGGACGCCGGCGCG
GGCCCCCTCGCGCTGTTCCTCTCGGGCCGCCGGGCGCCCTCCTGCCGCCGCGGCGACCGG
GTCAGCGACGGCGGCGACGCGGCGCTGATACGGGAACTCCGGCTGCTGCGCGGCACCGAC
CCCGCGATGCTGGACGACCCCGAGATCGTCGAGATGATCCTGCCCGCGCTGCGCGCCGAC
TACCGGGCGATCGAATCCCACCGCTGCCCGCCCGACGCCGCGGTGCGCTGCCCGGTCACC
GTGCTCACCGGTGACGCCGACCCGCACACCACCGTCGAGGAGGCGCGGGCCTGGTCCGGT
CACACCACCGGCGGCTGCGACATCGAGATCTTCCCCGGTGGCCACTTCTTCCTCGCGGAC
CGGTCCGCGGACGTCCTCGCCGCCGTCGCCCGACGACTGCGGACGCTCGCGGCGACGGCA
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001031 Thioesterase (Domain)
 [29-251]  3.09999999999998e-57 PF00975
PF00975   Thioesterase
SignalP
 [1-9]  0.524 Signal
Bacteria, Gram-negative   
TMHMM No significant hit