close all open/close all

CDS information : Strply_00290


close this sectionLocation

Organism
StrainNRRL 2433 (=NBRC 13058)
Entry nameStreptolydigin
Contig
Start / Stop / Direction46,154 / 35,811 / - [in whole cluster]
46,154 / 35,811 / - [in contig]
Locationcomplement(35811..46154) [in whole cluster]
complement(35811..46154) [in contig]
TypeCDS
Length10,344 bp (3,447 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)polyketide synthase type I
Gene
Gene (GenBank)slgA3
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[19875077] Deciphering biosynthesis of the RNA polymerase inhibitor streptolydigin and generation of glycosylated derivatives. (Chem Biol. , 2009)

close this sectionPKS/NRPS Module

6 malonyl-CoA
7 malonyl-CoA
KS39..375
AT546..871
DH922..1089
KR1458..1629
ACP1736..1806
KS1837..2213
AT2377..2695
kr3075..3253
ACP3366..3436

close this sectionSequence

selected fasta
>polyketide synthase [polyketide synthase type I]
MENQMTNPDEKVVAALRASLKETERLRQHNRELVDRSHEPLAIVGMSCRFPGGVRTPEDL
WRLVAGGEDAVSEFPADRGWNTDVLRGEGGFVHDAADFDAGFFGISPREALAMDPQQRLL
LETSWEAVERAGLDPRALRGSRTGVFTGVMYHDYADLVLRSPDAVEGYVYNGSAGSIASG
RVSYVLGLEGPAVTVDTACSSSLVALHLAAQALRSGECTLALAGGAAVMSTPVLFDEFAR
GQGIGLASDGRCKAFADSADGTNLSEGVGVLLLERLSDARRNGHPVLAVVAQARLTCADV
DAVEAHGTGTALGDPIEAQALLETYGQQREGQQPLWLGSLKSNIGHTQAAAGVGGVMKMV
LALRHGVLPRTLHVDRPSRHVDWSAGAVSLLTEQVPWPETGRPRRAGVSSFGVSGTNAHV
IVEQAPDDQEPAERAASAEPEAPLSDTDADVARPLPVPWVLSARSGAALCAQAARLRAHL
AAAHETDSPRVTALALATTRTAFEHRAVLHSGGPGGLSAALDALAEGRTAPSVVRGPGRR
EGRTAFLFTGQGSQYAGMGRELYAGSPAFAAALDEVTRHLDPHLERPLLDVLFAEPDSPD
AAAIDRTRYTQAGLFAVEVALFRLVEGWGLRPDALLGHSIGELAAAHVAGVFDLADACRL
VAARGRLMQDLPTGGAMVSVRAGEDDVRPLLAGQEDRVGIAAVNGPRSVVVSGDEDAVLA
VAAELAGRGHRTKRLNVSHAFHSPRMDPMLRDFRRLAETVDFHPPRIPVISNVTGRTATA
EELCAPEYWVQHIRQAVRFGDGIRALRDLGVGTYLELGPGGVLCAMGQEALGDGPAASAG
DSPFAATLRRGRPEPESVLEAVAAAFVRGTDVDWAAYLGGGDGRRRRVDLPTYAFQRQRY
WPRNPLTHSGDAASLGLEDAAHPLLAAVVEAPGTGELVLTGRLSLAAQPWLADHTVLGSA
VLPGTALVELALRAGERAGCDVLDELTLETPVVLPTDGGLQLRLLIGPPGEAGRRTLTVH
SRPDGDPAGTPWTRHAGGTLVAAAAHALPSRPFEATAWPPPGAEPLEVAGWYRRGSEAGV
AYGPAFQGLRAAWRRGDEVFAEVALPSEADTAGDADRYGLHPALLDAALQTVGLAPGAAD
EEARPRMPFAWRGVRLYATGARTLRVRLTVLTEDTAEGDGSAGTGIALDVADTAGAPVAT
VHSLALRPVTAGQVEGVRNAVREALYRVTWQPLTTGSTGATGATRMIESTGGTENLDRQA
TSYAVIGDDRGTGHGHGAGDGDRSDGWCAEVAAALPGAVRSADLASLASVPDVVVVPCSG
ELHPALHRVLALVQQYLADERFASSRLVVLTRGAVAAGPNEELPGLAHAPVWGLLRSAQS
EHPDRFVLVDVDTATDTGVDSRTGGGAGGVAASLRVLGAVVACGEPQVAVRGGVLWVPRV
VRARVPVVGAQGGVWGEGAVLVTGASGVLAGVVVRHLVSACGVRRVVLVSRRAAEQLAAE
VRELGADAVVVACDVADRGVLAGVFAAHRISAVVHAAGVLDDGVVGSLSPERVGGVLRPK
VDGAVVLDEVSRGVDLKAFVLFSSAAGTLGGPGQGSYAAANAFLDALAQRRRALGLPATS
LGWGLWDTSGGMTDELTDTDRHRLSRSGVQGLSTGDGLALFDAACATEEAHLVPLRLDLP
ALRAAADGSGDVPAMLRGLVPKTLRRAAAEAPDADPAQSFAQRLRALPEDERQEAGLRLV
CEQTAEILGYAGPDEVPAERAFNELGFDSLTALELRNRLTASTGLQLPATLVFDHPTPEA
LARHLTGEVTGAGGTASAPVPTPTVPPACSLSEADDDPVVIVSMACRYPGGVRTPEQLWQ
LVASGSDVISDFPADRGWHTEELYHPDPDHPGTTYSCEGGFLYDAGDFDAGFFGISPREA
LAMDPQQRLLLETSWEAVERAGLDPRALRGSRTGVFTGVMYHDYGSGLDDVPEDVEAFLG
NGSAGSIASGRVSYALGLEGPAVTVDTACSSSLVALHLAAQALRSGECTLALAGGATVMA
TPGTFVGFSRQRGLAADGRCKAFADGADGTGWGEGVGVLLLERLSDARRNGHPVLAVVRG
SAVNQDGASNGLTAPNGPAQQRVIRQALDHARLGPADVDAVEGHGTGTTLGDPIEAQALL
ATYGQRPEDQHPLWLGSLKSNMGHTQAAAGVGGVMKMVLALRHGVLPRTLHVDRPSRHVD
WSAGAVSLLTEQVPWPETGRPRRAGVSSFGISGTNAHVILEQPAPVAMGAGSDTSDVPNQ
PGGPAPVLPWVLSARTPAALREQAAALGELLTERPETAAADLGFSLATTRTAFEHRAAVV
AGDRAGALAALASLARGESAPGALRGTATAGARTAVLFSGQGSQRAGMGTELYASFPVYA
RAFDEVCAHLDPRLARPLREVVFAAPESPDAALLDRTEYAQPALFAVEVALFRLWESWGL
RPDAVAGHSIGELAAAHVAGVFDLADAARLVTARGGVMQALPGGGAMVSLQAAEDEVLPL
LAGREREVAVAAVNGPASVVVSGTEGAVADVAAHFEALGRRTRRLRVSHAFHSPLMDPAL
DAFRQVAREVTYHAPRIPLVSDVTGDTATDEQLADPEYWVRHAREAVRFADQVRTLAGRG
VTTFVEVGPDAVLTAMARESRSADAVAVASLRRDRPECRAVATALAELHVGGVRVDWQGV
FADTGARRVELPTYAFQRDRYWLRSGPSAAGARAARSATPNAPAPVRPDGAPEDRFWRAV
ADRDLGALATLLDVDSAREEPSLKAVLALLSDWRDGRAEVPAAAGPGDAEPGADWFHRLA
WHPLTDRATAPAPTGTWLVVAPARRPDDALVAATVAALEEGGAEVVLVEPAGEAGNEADD
TDGDRAAAGAASLADRLHRAAGGRQIEGVLSLLGLAEGEGPGHPGTAPGPALTLELLRAL
DAGDVPGGRAPVWVATRGAVSVGRSDRPADPAQAQTWGLGRAAAREAADRWGGLVDLPVD
LDVRARARLRAVLAGAIGGDAKGANSEAGALTETGTAGASPENEVALRPSGAYARRLVPA
PQPATGRAPAWTTRGTALLTDVTTPEGPHLARWLARAGAEHLVLLAPPGTDTPEQLADEL
AELTAEVTVARCDTRDRAALAALLDSLTASGRPVRTVVHTTGTPHPAPPSGTPRAVLADT
LPARVAGAEHLAELLDHDALDAFVVCSSAAGTWGAEGQAAAAAADAHLSAWAARRRESGL
PVTVVAWGPWAGNDPTDGAATGDGLTPLPPAAAVRALHRILDAGGGTDRIVADVDWERYV
AGCPAGRISPLFRELPPVQAALAAHAAPYGRDGDAPGQATGPGDWTPEELRRRLAGLPAD
QRPALLLELVRARSATVLGHADPRSVGADDDFLDIGFASMTAVELRNQLVADTGVELPPT
LIYDCPTPAALATYLLEEVQQLKEPVS
selected fasta
>polyketide synthase [polyketide synthase type I]
GTGGAGAACCAGATGACCAACCCTGACGAGAAGGTCGTCGCCGCCCTGCGGGCCTCCCTC
AAGGAGACCGAGCGGCTGCGGCAGCACAACCGTGAACTCGTCGACCGTTCCCATGAGCCC
CTCGCGATCGTCGGGATGAGCTGCCGCTTCCCCGGTGGCGTCCGGACTCCGGAGGACCTG
TGGCGACTGGTGGCCGGGGGCGAGGACGCGGTCTCGGAGTTCCCCGCCGACCGCGGCTGG
AACACCGACGTCCTGCGCGGTGAAGGCGGGTTCGTCCACGACGCGGCGGATTTCGATGCG
GGGTTCTTCGGGATTTCGCCGCGTGAGGCGTTGGCGATGGATCCGCAGCAGCGGTTGCTG
CTGGAGACGTCGTGGGAGGCGGTCGAGCGGGCGGGGCTGGATCCCCGTGCCCTGCGGGGC
AGCCGTACCGGTGTCTTCACCGGCGTGATGTACCACGACTACGCCGACCTCGTACTCCGC
TCTCCGGACGCGGTCGAGGGCTATGTGTACAACGGCAGTGCGGGCAGCATCGCGTCGGGC
CGGGTGTCGTACGTGCTCGGATTGGAGGGCCCGGCGGTGACGGTGGACACCGCGTGCTCG
TCGTCGCTGGTCGCCCTGCATCTGGCGGCACAGGCGCTGCGCAGCGGCGAGTGCACCCTC
GCACTCGCCGGCGGCGCCGCGGTGATGTCCACGCCGGTGCTGTTCGACGAGTTCGCGCGC
GGGCAGGGCATCGGGCTGGCGTCCGACGGGCGCTGCAAGGCGTTCGCGGACAGCGCGGAC
GGTACGAACCTCTCCGAGGGCGTGGGGGTGCTGCTGCTGGAGCGGTTGTCGGACGCACGG
CGCAACGGGCATCCGGTGCTCGCCGTGGTTGCCCAGGCCCGGCTGACCTGCGCCGACGTC
GACGCCGTGGAGGCGCACGGCACCGGCACCGCGCTCGGCGACCCCATCGAGGCGCAGGCG
CTGCTGGAGACGTACGGGCAGCAGCGCGAGGGTCAACAGCCGCTGTGGCTGGGCTCGTTG
AAGTCCAACATCGGGCACACCCAGGCCGCGGCCGGGGTGGGTGGTGTGATGAAGATGGTG
CTGGCGTTGCGGCACGGGGTGCTGCCCCGGACGCTGCATGTGGACCGGCCGTCGCGGCAC
GTGGACTGGTCGGCAGGCGCGGTGTCGCTGCTGACCGAGCAGGTTCCCTGGCCGGAGACC
GGCAGGCCACGCCGGGCCGGCGTCTCCTCCTTCGGCGTCAGCGGCACCAACGCGCACGTC
ATCGTCGAACAGGCCCCGGACGACCAGGAGCCGGCGGAACGGGCGGCGTCGGCGGAACCG
GAGGCTCCTCTCTCCGACACCGACGCCGACGTCGCCCGTCCGCTTCCCGTCCCCTGGGTG
CTCTCTGCCCGCTCCGGGGCCGCGCTGTGTGCCCAGGCGGCGCGGTTGCGCGCCCACCTG
GCGGCGGCCCACGAGACCGACAGCCCGCGCGTGACCGCCCTCGCCCTCGCCACCACCCGC
ACCGCCTTCGAGCACCGGGCGGTGCTGCACTCCGGTGGTCCCGGCGGACTGTCCGCGGCC
CTCGACGCCCTCGCCGAGGGCCGGACCGCGCCGTCCGTGGTGCGTGGTCCGGGCCGCCGC
GAGGGCCGGACCGCCTTCCTGTTCACCGGCCAGGGCAGCCAGTACGCCGGCATGGGACGC
GAGCTGTACGCCGGCAGTCCGGCGTTCGCCGCGGCACTGGACGAGGTCACCCGGCACCTC
GATCCGCACCTCGAACGGCCCCTGCTCGACGTCCTGTTCGCCGAACCCGACTCACCCGAC
GCGGCGGCGATCGACCGGACCCGCTACACCCAGGCCGGGCTCTTCGCCGTCGAGGTCGCG
CTGTTCCGGCTGGTGGAGGGCTGGGGGCTGCGCCCCGACGCGCTGCTGGGGCACTCCATC
GGGGAGCTGGCCGCCGCGCATGTCGCGGGGGTCTTCGACCTGGCCGACGCCTGCCGGCTG
GTCGCTGCCCGCGGGCGGCTGATGCAGGACCTTCCCACCGGCGGCGCGATGGTGTCCGTC
CGGGCGGGCGAGGACGACGTACGGCCGCTGCTCGCCGGACAGGAGGACCGGGTGGGCATC
GCGGCCGTCAACGGGCCCCGGTCCGTGGTCGTGTCCGGTGACGAGGACGCGGTCCTCGCC
GTGGCCGCCGAACTGGCCGGCCGCGGTCACCGCACCAAGCGGCTCAACGTCAGCCACGCC
TTCCACTCCCCGCGCATGGACCCCATGCTGCGGGACTTCCGGCGCCTCGCGGAAACCGTG
GACTTCCACCCGCCGCGCATCCCCGTCATCTCCAACGTGACCGGGCGTACCGCCACGGCG
GAGGAGTTGTGCGCACCCGAGTACTGGGTGCAGCACATCCGGCAGGCGGTGCGCTTCGGC
GACGGCATCCGCGCGCTGCGCGATCTCGGCGTCGGTACGTACCTGGAGCTCGGACCGGGC
GGGGTGCTGTGCGCCATGGGGCAGGAAGCCCTCGGTGACGGGCCGGCGGCGTCGGCGGGC
GACTCGCCGTTCGCCGCGACGCTGCGCCGCGGCCGCCCCGAACCGGAGTCGGTGCTGGAG
GCCGTCGCCGCGGCCTTCGTGCGCGGCACGGACGTCGACTGGGCCGCGTATCTCGGCGGC
GGTGACGGCCGCCGGCGGCGGGTGGACCTGCCCACGTACGCGTTCCAGCGGCAGCGTTAC
TGGCCGAGGAACCCGCTCACCCACAGTGGTGACGCGGCGTCCCTGGGGCTGGAGGACGCG
GCCCACCCGCTGCTCGCCGCGGTCGTCGAGGCTCCCGGAACCGGCGAACTGGTCCTCACC
GGGCGGCTGTCGCTCGCTGCCCAGCCCTGGCTGGCCGATCACACCGTTCTGGGCAGTGCC
GTCCTGCCGGGCACCGCCCTGGTGGAACTGGCGCTGCGGGCCGGCGAACGGGCCGGCTGC
GACGTCCTGGACGAACTGACGCTGGAGACCCCGGTCGTGCTGCCCACCGACGGTGGGCTG
CAGCTCAGGCTGCTCATCGGGCCCCCCGGCGAGGCCGGGCGCCGCACGCTCACTGTGCAC
TCCCGCCCGGACGGCGACCCGGCGGGCACGCCCTGGACGCGGCACGCCGGCGGCACCCTG
GTGGCAGCGGCGGCCCATGCCCTCCCGTCGCGGCCGTTCGAGGCGACGGCCTGGCCGCCG
CCGGGCGCCGAACCGCTGGAGGTGGCCGGCTGGTACCGGCGAGGCAGCGAGGCCGGTGTC
GCCTACGGCCCGGCCTTCCAGGGGCTGCGGGCGGCCTGGCGGCGCGGCGACGAGGTGTTC
GCCGAGGTGGCCCTGCCGTCCGAGGCCGACACCGCCGGGGATGCCGACCGGTACGGCCTG
CACCCGGCGCTGCTCGACGCCGCCCTCCAGACCGTCGGCCTGGCCCCGGGCGCGGCGGAC
GAGGAGGCGCGCCCCCGCATGCCGTTCGCCTGGCGTGGCGTACGGCTGTACGCCACGGGC
GCGCGCACCCTGCGCGTCCGGCTGACCGTCCTGACCGAGGACACCGCCGAGGGCGACGGC
TCCGCCGGTACCGGGATCGCCCTGGACGTCGCCGACACCGCGGGCGCGCCGGTCGCCACG
GTCCACTCGCTGGCGCTGCGGCCGGTCACCGCGGGCCAGGTGGAGGGCGTACGGAACGCC
GTACGGGAGGCGTTGTACCGGGTGACCTGGCAGCCGCTGACCACCGGGAGCACCGGGGCC
ACCGGCGCCACCAGGATGATCGAGAGCACCGGTGGCACCGAGAACCTCGATCGGCAGGCG
ACGAGTTACGCGGTGATCGGCGACGACCGCGGCACCGGCCACGGCCACGGCGCTGGCGAC
GGCGACCGGTCGGACGGCTGGTGCGCCGAGGTCGCCGCCGCACTGCCCGGCGCCGTACGC
AGCGCCGATCTCGCCTCGCTGGCCTCCGTACCCGACGTGGTGGTCGTGCCCTGCTCGGGA
GAGCTGCACCCGGCCCTGCACCGGGTGCTGGCGCTGGTGCAGCAGTACCTGGCCGATGAG
CGCTTCGCCTCGTCGCGGCTGGTCGTCCTCACCCGGGGGGCCGTCGCGGCCGGACCGAAC
GAAGAGCTGCCCGGACTGGCGCACGCCCCGGTGTGGGGTTTGTTGCGGTCGGCGCAGTCG
GAGCATCCGGACCGGTTCGTGCTGGTGGACGTGGATACAGCCACGGACACGGGCGTGGAC
TCGCGCACGGGCGGTGGCGCTGGTGGTGTGGCCGCGTCTTTGCGGGTGTTGGGTGCGGTG
GTGGCGTGTGGGGAGCCGCAGGTTGCGGTGCGTGGGGGAGTGTTGTGGGTGCCTCGTGTT
GTTCGGGCGCGGGTGCCGGTGGTGGGTGCGCAGGGTGGTGTGTGGGGCGAGGGTGCGGTG
CTGGTGACGGGTGCCAGTGGTGTGCTGGCGGGTGTGGTGGTGCGGCACTTGGTGAGTGCC
TGTGGGGTGCGTCGTGTGGTGTTGGTGTCGCGTCGTGCTGCTGAGCAACTAGCCGCTGAG
GTACGTGAGTTGGGTGCCGATGCGGTGGTGGTGGCGTGTGATGTGGCGGATCGTGGTGTG
TTGGCGGGGGTGTTTGCTGCGCATCGGATTTCGGCTGTGGTGCATGCGGCGGGTGTGTTG
GATGACGGTGTGGTGGGGTCGTTGTCGCCGGAGCGGGTGGGGGGTGTGCTGCGGCCGAAG
GTGGACGGGGCGGTGGTGTTGGATGAGGTGTCGCGGGGTGTGGATCTGAAGGCGTTTGTG
CTGTTTTCTTCTGCGGCGGGGACGTTGGGTGGTCCGGGGCAGGGGAGTTATGCGGCGGCG
AATGCGTTTTTGGACGCGTTGGCACAGCGACGTCGAGCGCTCGGCCTGCCCGCCACCTCC
CTCGGCTGGGGCCTGTGGGACACCTCCGGCGGCATGACGGACGAGCTGACCGACACCGAC
CGTCACCGGCTGAGCCGGTCCGGCGTCCAGGGGCTCTCCACGGGCGACGGCCTGGCGCTG
TTCGACGCGGCCTGCGCCACGGAAGAGGCGCACCTCGTGCCGCTCCGGCTGGACCTCCCC
GCGCTGCGGGCAGCCGCCGACGGGTCCGGTGACGTACCGGCCATGCTGCGCGGGCTGGTG
CCGAAGACCTTGCGTCGCGCTGCGGCGGAGGCCCCGGACGCGGATCCGGCGCAGTCCTTC
GCCCAGCGCCTGCGCGCGCTGCCCGAGGACGAGCGCCAAGAGGCCGGCCTGCGCCTGGTC
TGTGAGCAGACCGCCGAGATCCTGGGCTATGCGGGGCCTGACGAGGTGCCCGCCGAGCGG
GCCTTCAACGAGCTGGGCTTCGACTCGCTGACCGCCCTGGAGCTGCGTAACCGTCTCACC
GCGTCGACCGGGCTCCAGCTGCCCGCGACGCTGGTCTTCGACCACCCCACGCCCGAGGCG
CTGGCCCGTCACCTCACCGGTGAGGTCACCGGGGCGGGCGGAACGGCGAGCGCGCCGGTG
CCCACGCCCACGGTCCCGCCCGCGTGCTCGCTCTCCGAGGCCGACGACGACCCGGTCGTC
ATCGTCTCCATGGCCTGCCGCTACCCGGGCGGCGTCCGCACCCCGGAACAGCTGTGGCAG
CTCGTCGCCTCCGGCAGCGACGTGATCTCCGACTTCCCCGCCGACCGCGGCTGGCACACC
GAGGAGCTCTACCACCCGGACCCGGACCACCCCGGCACGACCTACTCCTGCGAGGGCGGA
TTCCTCTACGACGCGGGCGACTTCGATGCGGGGTTCTTCGGGATTTCGCCGCGTGAGGCG
TTGGCGATGGATCCGCAGCAGCGGTTGCTGCTGGAGACGTCGTGGGAGGCGGTCGAGCGG
GCGGGGCTGGATCCCCGTGCCCTGCGGGGCAGCCGTACCGGTGTCTTCACCGGCGTGATG
TACCACGACTACGGCAGCGGACTGGACGACGTACCCGAGGACGTCGAGGCGTTCCTCGGC
AACGGCAGCGCGGGCAGCATCGCCTCCGGCCGGGTGTCGTACGCCCTCGGGCTGGAGGGC
CCGGCGGTGACGGTGGACACCGCGTGCTCGTCGTCGCTGGTGGCGCTGCATCTGGCGGCA
CAGGCGCTGCGCAGCGGCGAGTGCACCCTCGCACTCGCCGGCGGGGCGACCGTGATGGCC
ACCCCGGGGACCTTCGTCGGGTTCAGCCGGCAGCGGGGCCTCGCCGCCGACGGGCGGTGC
AAGGCGTTCGCCGACGGCGCGGACGGCACCGGCTGGGGCGAGGGCGTGGGGGTGCTGCTG
CTGGAGCGGCTGTCGGACGCACGGCGCAACGGGCATCCGGTGCTCGCCGTGGTCCGTGGC
AGCGCCGTCAACCAGGACGGTGCCAGCAACGGCCTGACCGCCCCCAACGGCCCCGCCCAG
CAACGCGTCATTCGGCAGGCCCTCGACCACGCGCGCCTCGGGCCGGCGGATGTCGACGCG
GTCGAGGGGCACGGCACCGGCACCACGCTCGGCGACCCCATCGAGGCGCAGGCACTGCTC
GCCACCTACGGGCAGCGGCCTGAGGACCAACACCCGCTGTGGCTGGGCTCGTTGAAGTCC
AACATGGGACACACCCAGGCCGCGGCCGGGGTGGGTGGTGTGATGAAGATGGTGCTGGCG
TTGCGGCACGGGGTGTTGCCCCGGACGCTGCATGTGGACCGGCCGTCGCGGCACGTGGAC
TGGTCGGCGGGCGCGGTGTCGCTGCTGACCGAGCAGGTTCCCTGGCCGGAGACCGGCAGG
CCGCGCCGGGCCGGTGTCTCCTCCTTCGGGATCAGCGGCACCAACGCGCACGTGATCCTG
GAGCAGCCCGCCCCCGTGGCCATGGGCGCAGGCTCCGACACGTCCGACGTCCCCAACCAG
CCCGGCGGACCGGCGCCCGTGCTGCCGTGGGTGCTCTCCGCCAGGACGCCCGCGGCGCTG
CGCGAACAGGCTGCGGCGCTGGGGGAGTTGCTCACCGAGCGGCCGGAGACCGCCGCCGCG
GACCTGGGGTTCTCGCTCGCCACCACCCGTACCGCCTTCGAGCACCGCGCCGCGGTCGTC
GCCGGGGACCGGGCCGGTGCCCTGGCGGCGCTGGCCTCCCTGGCCCGGGGGGAGAGCGCG
CCCGGCGCCCTGCGGGGAACCGCGACGGCCGGCGCCAGGACCGCGGTCCTCTTCTCCGGT
CAGGGCAGTCAGCGCGCGGGCATGGGGACGGAGCTGTACGCCTCCTTCCCCGTCTACGCA
CGGGCCTTTGACGAGGTCTGCGCCCACCTCGACCCGCGGCTGGCACGGCCGCTGCGCGAG
GTGGTGTTCGCGGCGCCCGAGTCGCCGGACGCCGCGCTGCTGGACCGTACGGAGTACGCG
CAGCCGGCCCTGTTCGCCGTCGAGGTCGCGCTGTTCCGGCTGTGGGAGAGCTGGGGCCTG
CGGCCGGACGCGGTGGCCGGGCACTCGATCGGCGAGCTCGCGGCGGCCCATGTCGCCGGG
GTGTTCGACCTGGCCGACGCGGCCCGGCTGGTGACCGCCCGGGGCGGGGTGATGCAGGCG
CTGCCCGGTGGCGGGGCCATGGTGTCCCTCCAGGCCGCCGAGGACGAGGTGCTGCCGCTG
CTGGCCGGACGCGAACGAGAGGTGGCCGTCGCGGCGGTGAACGGCCCGGCGTCGGTGGTC
GTCTCCGGCACCGAGGGCGCCGTCGCCGACGTCGCCGCGCACTTCGAGGCGCTGGGGCGC
AGGACCCGCCGGCTGCGGGTGAGCCACGCCTTCCACTCGCCGCTGATGGATCCGGCCCTG
GACGCCTTCCGGCAGGTGGCCCGCGAGGTGACCTACCACGCCCCGCGCATCCCGCTGGTC
TCGGACGTCACCGGTGACACCGCGACGGACGAGCAGCTGGCCGACCCCGAGTACTGGGTG
CGCCACGCCCGGGAGGCGGTGCGCTTCGCGGACCAGGTGCGCACGCTGGCCGGCCGGGGC
GTGACCACCTTCGTCGAGGTGGGGCCGGATGCCGTACTGACCGCCATGGCGCGGGAGAGC
CGGAGCGCGGACGCGGTGGCCGTGGCGAGCCTGCGCAGGGACCGGCCGGAGTGCCGGGCG
GTGGCTACCGCCCTCGCCGAACTCCACGTCGGCGGCGTGCGCGTGGACTGGCAGGGCGTA
TTCGCGGACACCGGTGCGCGACGGGTGGAGCTGCCGACGTACGCGTTCCAGCGGGACCGC
TACTGGCTGCGGTCCGGCCCGTCTGCCGCGGGCGCCCGCGCCGCCCGGTCCGCCACGCCG
AACGCCCCCGCGCCGGTACGGCCGGACGGGGCGCCCGAGGACCGCTTCTGGCGGGCGGTC
GCGGACCGCGATCTCGGCGCGCTGGCCACCCTGCTGGACGTGGACTCGGCACGCGAGGAG
CCCTCGCTGAAGGCTGTGCTCGCGCTGCTGTCCGACTGGCGCGACGGCCGCGCCGAGGTG
CCGGCCGCGGCGGGACCGGGCGACGCCGAACCGGGCGCGGACTGGTTCCACCGTCTCGCC
TGGCACCCGCTGACCGACCGTGCCACCGCGCCGGCCCCCACCGGCACCTGGCTGGTCGTC
GCCCCGGCCCGCCGCCCGGACGACGCCCTGGTGGCGGCCACGGTCGCGGCGCTGGAGGAG
GGCGGCGCCGAGGTGGTCCTGGTCGAGCCGGCGGGGGAGGCGGGCAACGAGGCGGACGAC
ACCGACGGGGACCGCGCCGCGGCCGGCGCTGCCTCGCTCGCGGACCGGCTGCACCGTGCG
GCCGGCGGACGGCAGATCGAGGGCGTGCTCTCGCTGCTGGGGCTCGCCGAGGGGGAGGGG
CCCGGACACCCCGGCACCGCCCCTGGCCCGGCCCTCACCCTGGAACTGCTGCGCGCCCTC
GACGCCGGGGACGTGCCGGGTGGCAGGGCACCGGTCTGGGTGGCCACCCGCGGCGCCGTA
TCGGTCGGCCGCTCCGACCGGCCGGCCGACCCTGCCCAGGCGCAGACCTGGGGGCTGGGC
CGGGCCGCCGCCCGGGAGGCGGCCGACCGCTGGGGCGGTCTGGTCGACCTGCCTGTGGAC
CTCGACGTGCGGGCCCGGGCCCGGCTGCGTGCGGTACTCGCCGGCGCGATCGGAGGGGAC
GCGAAGGGAGCGAACAGTGAGGCCGGCGCGCTCACGGAGACCGGAACGGCCGGCGCGAGC
CCGGAGAACGAGGTTGCCCTGCGGCCGTCCGGCGCGTACGCCCGGCGTCTCGTGCCGGCC
CCGCAGCCGGCCACCGGCCGCGCCCCCGCCTGGACCACGCGCGGTACGGCACTGCTCACC
GACGTGACGACGCCCGAGGGCCCGCACCTCGCCCGCTGGCTGGCCCGCGCCGGTGCCGAA
CACCTGGTGCTGCTGGCACCGCCCGGCACCGACACGCCCGAACAACTCGCCGACGAACTG
GCCGAGTTGACAGCCGAGGTCACCGTCGCCCGGTGCGACACCCGCGACCGGGCGGCGCTG
GCCGCGCTGCTCGATTCGCTGACCGCGAGCGGCCGGCCGGTGCGTACGGTCGTGCACACG
ACCGGAACGCCGCACCCGGCCCCGCCGAGCGGCACCCCGCGCGCCGTCCTGGCCGACACC
CTGCCGGCCCGGGTCGCGGGCGCCGAGCACCTGGCCGAACTGCTCGACCACGACGCCCTG
GACGCCTTTGTCGTCTGCTCCTCCGCCGCCGGTACCTGGGGCGCCGAGGGGCAGGCGGCC
GCTGCCGCCGCCGACGCCCACCTCTCGGCCTGGGCCGCCCGCCGCCGGGAGTCGGGGCTG
CCGGTGACCGTGGTCGCCTGGGGGCCGTGGGCCGGGAACGACCCCACGGACGGGGCGGCC
ACGGGCGACGGACTCACCCCGCTGCCCCCGGCCGCGGCCGTCCGCGCGCTGCACCGGATC
CTCGACGCGGGCGGCGGCACCGACCGGATCGTGGCGGACGTGGACTGGGAGCGGTACGTC
GCCGGCTGCCCCGCCGGCCGCATCAGCCCGCTGTTCCGCGAACTACCGCCGGTACAGGCC
GCGTTGGCCGCACACGCCGCACCGTACGGCCGGGACGGGGACGCGCCGGGGCAGGCCACC
GGGCCGGGCGACTGGACGCCCGAGGAGCTGCGGCGGCGCCTGGCCGGACTGCCGGCGGAC
CAGCGGCCGGCCCTGCTGCTGGAGCTGGTCCGGGCCCGCTCCGCCACCGTGCTCGGCCAT
GCCGACCCGCGGTCCGTCGGCGCCGACGACGACTTCCTCGACATCGGCTTCGCCTCCATG
ACCGCCGTCGAACTGCGCAACCAACTGGTCGCGGACACCGGAGTGGAGCTGCCGCCGACC
CTGATCTACGACTGCCCCACACCGGCAGCCCTCGCCACGTACCTGCTCGAAGAAGTGCAA
CAGCTGAAGGAGCCCGTTTCATGA
[6] KS39..375
[6] AT546..871
[6] malonyl-CoA739..743
[6] DH922..1089
[6] KR1458..1629
[6] ACP1736..1806
[7] KS1837..2213
[7] AT2377..2695
[7] malonyl-CoA2569..2573
[7] kr3075..3253
[7] ACP3366..3436
[6] KS115..1125
[6] AT1636..2613
[6] malonyl-CoA2215..2229
[6] DH2764..3267
[6] KR4372..4887
[6] ACP5206..5418
[7] KS5509..6639
[7] AT7129..8085
[7] malonyl-CoA7705..7719
[7] kr9223..9759
[7] ACP10096..10308

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [535-671]  G3DSA:3.40.366.10 [739-861]  G3DSA:3.40.366.10 [2368-2501]  G3DSA:3.40.366.10 [2569-2684]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR006162 Phosphopantetheine attachment site (PTM)
 [1764-1779]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1736-1809]  7.60000000000006e-42 G3DSA:1.10.1200.10 [3366-3439]  7.60000000000006e-42 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1736-1806]  PS50075 [3366-3436]  PS50075
PS50075   ACP_DOMAIN
 [1740-1805]  5.90000000000001e-12 PF00550 [3371-3435]  9.30000000000002e-11 PF00550
PF00550   PP-binding
 [1729-1853]  6.50000805230168e-27 SSF47336 [3357-3441]  2.19999900980708e-19 SSF47336
SSF47336   ACP_like
IPR013968 Polyketide synthase, KR (Domain)
 [1458-1627]  2.50000000000001e-48 PF08659 [3075-3252]  4.9e-43 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [39-279]  7.59999999999998e-86 PF00109 [1837-2087]  4.40000000000003e-97 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [286-375]  2.89999999999999e-34 PF02801 [2095-2213]  3.2e-47 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [546-871]  3.30000000000002e-67 PF00698 [2377-2695]  7.5e-71 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [543-849]  2.39999798157263e-73 SSF52151 [2373-2679]  7.0999832511256e-74 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [673-738]  2.19999900980708e-19 SSF55048 [2503-2568]  5.59999989417023e-18 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [39-289]  G3DSA:3.40.47.10 [290-428]  3.60000000000002e-115 G3DSA:3.40.47.10 [1839-2099]  G3DSA:3.40.47.10 [2100-2263]  3.60000000000002e-115 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [31-373]  3.19999899046355e-83 SSF53901 [1829-2211]  7.6999848053369e-102 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1459-1635]  9.69999999999989e-49 G3DSA:3.40.50.720 [3075-3253]  1.40000000000001e-44 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [190-206]  PS00606 [2000-2016]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [547-852]  SM00827 [2377-2675]  SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1737-1809]  1.70000295590053e-35 SM00823 [3367-3439]  3.30000526807186e-28 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [922-1089]  6.29998179434741e-79 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [41-427]  SM00825 [1839-2265]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1458-1629]  2.99998750445706e-43 SM00822 [3075-3253]  3.49999466863949e-26 SM00822
SM00822   PKS_KR
SignalP No significant hit
TMHMM No significant hit