close all open/close all

CDS information : Strply_00300


close this sectionLocation

Organism
StrainNRRL 2433 (=NBRC 13058)
Entry nameStreptolydigin
Contig
Start / Stop / Direction56,758 / 46,319 / - [in whole cluster]
56,758 / 46,319 / - [in contig]
Locationcomplement(46319..56758) [in whole cluster]
complement(46319..56758) [in contig]
TypeCDS
Length10,440 bp (3,479 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)polyketide synthase type I
Gene
Gene (GenBank)slgA2
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[19875077] Deciphering biosynthesis of the RNA polymerase inhibitor streptolydigin and generation of glycosylated derivatives. (Chem Biol. , 2009)

close this sectionPKS/NRPS Module

4 methylmalonyl-CoA
5 methylmalonyl-CoA
KS51..426
AT590..905
KR1262..1442
ACP1560..1630
KS1656..2031
AT2193..2508
DH2557..2725
KR3099..3270
ACP3377..3447

close this sectionSequence

selected fasta
>polyketide synthase [polyketide synthase type I]
MSNMSKPDANAGSPATPNMTEEKLRDYLKRVVNDLRQTRRRLSEAEAKDHEPIAIVAMSC
RFPGEVRSPEELWRLVRDGGDAITAFPDNRGWDVETLYDPDPEHSGTTYVREGGFLHDAA
EFDPAFFGISPREALAMDPQQRLLLETSWEAFERAGIDPQSLRGSRTGVFVGSNYQDYAT
RLPEVPEEAEGHIGIGNTPSVVSGRVSYTFGLEGPAVTVDTACSSSLVALHLACHALRQG
DCTMALAGGISVMSSPASYIEFSRQRGLAPDARVKAFGAGADGTALSEGVGLFVVERLSD
AQRNGHPVLAVIRGSAINQDGASNGLTAPNGPSQERVIRQALAHARLTPDQVDVVEAHGT
GTTLGDPIEAQALLATYGQGRAEDQPLWLGSVKSNIGHTQAAAGAASLIKMIMAFDAATL
PRTLHADEPSHRIDWSAGAVELLTEEREWPSSPERVRRAGVSSFGISGTNAHLVLEEPPA
PEVEELPVVDAPGASASVVVPWVVSGRGEGALRAQAERLRSFVEARPELAPADIAYSLVT
SRAAVENRAVVLGTDRSGLLEGLGAVSRGEVPAAGVVQGAGAVREAGRTVLVFPGQGSQW
VGMGAELIASSPAFAESMRRCAEALAPFVDWDLLEVVSEGRGLDRVDVVQPVTWAVMVSL
AELWRSVGVVPDAVLGHSQGEIAAAVVAGALSLEDGARVVALRSQVIGRELAGRGGMASI
ALPEAEVRQRIAKTATLGVAAVNGLSSTVVSGDADAVEAFVVACEADGVRARRIAVDYAS
HSAHVEAIEQELLTVLEDVRPQAGSVPFYSTVENAFLDTEALDAAYWYRNLRHQVQFEAG
IRALATEGFTTFVESSAHPVLTVGIQETLDDTDAEAVVAGSLRRDEGGLERFLTSAAELY
VAGVPVDWTPFLAGEGIRRVDLPTYAFQRERFWLEVPASTAPVATAPLAGGDVVDSRFWA
AVEAEDWESLSGTLALAGDAPLSAVVPALASWRRERQRASTVQNWRYRVTWKPAPDARRT
AAVDGTWLVVVPTGHAEDAAVTGAVEALAEGGAYVEQLELSAADADRVAWRARIEEWHAA
AQLGDRPLAGVLSLLALDERPHAGHGAMAAGVAGTLALVQALEEAGIEARLWLGTRGAVS
VGGTDQVLSAVQAQVWGLGRVVALELPERWGGLVDLPEAWDGRAGARLCAVLAGALDDED
QLAVRGSGVFARRLVRAPLAAAGRADEAGAQPGAGASSGTGTGARTGTGTATDADAAWRT
RGTALVTGGTGALGPHIARWLADNGAEHVVLVSRRGAAAPGMAELRDELAAGGVRLTASA
CDVADRDAVAALLAGLAADGDTVRTVIHAAAFIELAALTEADPAEFADVLAAKVAGAAHL
DALLDPDDLDAFVLFSSIAGVWGSGDHGAYAAANAFLDALAEQRHARGLPASSIAWGVWD
VWDPERLPEGVKPEQLQARGLPFLDPDTAFSALRQVLAHNEACVTVADVDWDRFVPVFTS
AGPRPLLDGVPEAQQALDTGGGSVGAGGGGGATGVPADTSPSPLRDRLSGLAPAERHAVL
LDLVRAQAASVLGHASPEAVAPTRAFRDLGFDSLTAVELRNRLKNATGLRLPATLIFDYP
SPTVLAGFLRGEILGTEESAATAAAAPAVLPASDDDPIVIVGMACRFPGEVRSPEELWEL
LERGGEAISELPTDRGWDVESLYDPDPERPGKTYTRHGGFLYDAADFDAGFFGISPREAL
AMDPQQRLLLETSWEAFERAGIDPQTLRGSSTAVFAGVSYHDYGSRLQEAPEGVEGYLGT
GNTASIASGRVSYLLGLEGPAVTLDTGCSSSLVAVHLAAQSLRQGESSLALAGGASVMAV
PTSFTEFSRQRGLSVDGRCRAFSADADGMGMAEGAAMLLLERLSDARRNGHPVLAVVRGT
AMNQDGASNGLTAPNGPSQQRVIRQALANARLSPSEVDAVEAHGTGTRLGDPIEAQALLA
TYGQGRAEDRPLWLGSVKSNIGHTQAAAGAAGVIKMVKALEQGQLPRTLHAAEPAPQVDW
SAGAVELLTEEREWPSSPERVRRAGVSSFGISGTNAHLVLEEPPAAEVEELPVVDAPGAS
GAVVVPWVVSGRGVEALRAQAGRLRSFVGARPELGPVEVGRSLAVSRSAFERRAVVLGTD
RGALLGALGAVSRGEVPAAGVVEGAVREVGRTVLVFPGQGSQWVGMGAELIASSPAFAES
MRRCAEALAPFVDWDLLEVVSEGRGLDRVDVVQPVTWAVMVSLAELWRSVGVVPDAVLGH
SQGEIAAAVVAGGLSLEDGARVVALRSQVIGRELAGRGGMASIALPEPEVRDRLKSQTGL
GLAAVNGPLSTVISGDAAAVEAFVVACEADGVRARRIAVDYASHSAHVEAIEQELLTVLK
DVRPQAGSVPFYSTVENAFLDTEILDAAYWYRNLRHQVQFEAGIRALAADGFTTFVESSA
HPVLTVGIQETLDDTDTEAVVTGSLRRDEGGLERFLTSAAELYVTGVPVDWTPFLAGEGT
RPVDLPTYAFQRERFWLEASASAAGDMAAAGLTTASHPLLGAAVEVAGSDEVLFTGRLSL
ESHPWLADHAVAGTVLLPGTAFVELAVRAGDEVGCGQVEELALEAPLIVPERGGVALQLG
LGAADDSGRRALSIYSRAPGDERGPWTRHATGTLASAGVAETADVPAGTDLAVWPPVGAE
PIGIEGYYDRLAAQGYGYGPAFHGLRAAWRRGDELFAEVQLPEAVAADAAAFGLHPALLD
AALHTLGLGAVPDVGEGRARLPFSWSGVSLHRTGAAGLRVRVTPLDQDTVAVTVADPTGA
PVASIESLVTRPVSTESLRAASSPVRDAMFAVDWHQLPAAGSAAPVRHWAVLGSGEGADV
TDGAAAGHVAGLVSALERSGGTVSCHADLAALAAAQSQSPHDVPDVVVLPCLAGDREAAG
LAEATHDALRRVLGVVQAWLDDELFASSRLVVLTRGAVATTPDETELDLPHAAVWGLLRS
AQSEHPDRFVLVDVDTAMDTDMDTDMDTDMDTDMDTAVDSGTDSGVESDAGMGSVRVLGS
VVACGEPQVAVRGGVLWVPRVVRARVPVVGAQGGVWGEGAVLVTGASGVLAGVVVRHLVS
ACGVRRVVLVSRRAAEQLAAEVRELGADAALVACDVADRGVLAGVFAAHRISAVVHAAGV
LDDGVVGSLSPERVGGVLRPKVDGAVVLDEVSRGVDLKAFVLFSSAAGTLGGPGQGSYAA
ANAFLDALAQRRRALGLPATSLGWGFWEERSGLTGHLGRADLNRMSRVGIAPMTSQEGLA
LFDAACATDEPMLLPMRLETSALRALAASGTVPPLLSALVRTPVRRTAADGGGAANGAES
LQERLSKVSAAERAGALEDLVVAQVASVLGHASVAAVEPGRPFKELGFDSLTAVELRNRL
KNATGLRLPATLVFDHPTPEAVAAHLGAKLFPEAANTAPDAGAPDIDHLVSLALDGKDG
selected fasta
>polyketide synthase [polyketide synthase type I]
ATGTCGAATATGTCGAAGCCCGACGCGAACGCCGGCTCCCCCGCCACCCCGAACATGACC
GAGGAAAAGCTCCGCGATTACCTCAAGCGCGTCGTCAACGATCTGCGCCAGACCCGTCGC
CGACTGAGCGAGGCGGAGGCGAAGGACCACGAGCCGATCGCCATTGTCGCCATGAGCTGC
CGTTTCCCCGGTGAGGTGCGGTCGCCGGAAGAGCTGTGGCGACTGGTGCGCGACGGCGGC
GACGCCATCACCGCATTTCCCGACAACCGTGGCTGGGACGTCGAGACGCTGTACGACCCG
GACCCGGAGCACTCGGGCACGACGTACGTACGCGAAGGCGGCTTCCTGCACGACGCGGCG
GAATTCGACCCGGCGTTCTTCGGGATTTCGCCGCGTGAGGCGTTGGCGATGGATCCGCAG
CAGCGGTTGCTGCTGGAGACGTCGTGGGAGGCGTTCGAGCGGGCCGGAATTGACCCGCAG
TCGCTGCGCGGTTCACGCACGGGCGTTTTCGTCGGCTCCAATTACCAGGACTACGCCACC
CGTCTGCCCGAGGTGCCCGAAGAGGCGGAGGGCCATATCGGCATCGGCAATACGCCGAGT
GTGGTCTCGGGCCGGGTCTCGTACACGTTCGGGCTGGAGGGTCCGGCGGTGACGGTGGAC
ACCGCGTGCTCGTCGTCGCTGGTCGCCCTGCATCTGGCCTGCCATGCGCTGCGCCAGGGC
GACTGCACGATGGCGCTGGCCGGCGGCATCTCCGTGATGTCCTCCCCCGCTTCGTACATC
GAGTTCAGCAGGCAGCGGGGGCTCGCGCCGGACGCCCGGGTCAAGGCGTTCGGCGCGGGC
GCGGACGGCACGGCGCTGTCCGAGGGCGTGGGCCTGTTCGTCGTGGAACGGCTGTCGGAC
GCCCAGCGCAACGGCCACCCGGTGCTCGCCGTCATTCGTGGCAGCGCCATCAACCAGGAC
GGTGCGAGCAACGGCCTGACGGCCCCCAACGGCCCGTCCCAGGAGCGCGTCATTCGCCAG
GCACTGGCGCACGCCCGCCTGACCCCGGACCAGGTGGACGTGGTGGAGGCGCACGGCACC
GGTACGACGCTGGGCGATCCGATCGAGGCACAGGCGTTGCTGGCGACCTACGGGCAGGGC
CGGGCGGAGGACCAGCCGCTGTGGCTCGGTTCGGTGAAGTCGAACATCGGCCACACCCAG
GCCGCCGCGGGTGCCGCCTCCCTCATCAAGATGATCATGGCGTTCGATGCGGCGACCCTG
CCGCGCACGCTGCATGCCGACGAGCCCTCACACCGCATCGACTGGTCGGCGGGTGCGGTG
GAACTGCTGACGGAGGAGCGGGAGTGGCCGTCGTCCCCGGAGCGGGTGCGGCGGGCCGGT
GTCTCGTCGTTCGGGATCAGCGGCACCAACGCACATCTCGTACTGGAGGAGCCACCGGCC
CCGGAGGTCGAGGAGCTGCCGGTGGTGGATGCCCCGGGGGCTTCCGCGTCGGTCGTGGTG
CCGTGGGTGGTCTCGGGGCGTGGTGAGGGGGCGTTGCGGGCGCAGGCGGAGCGGCTGCGG
TCGTTCGTCGAGGCGAGGCCGGAGCTGGCACCGGCCGATATCGCGTACTCCCTGGTGACG
AGCCGGGCCGCGGTGGAGAACCGTGCGGTGGTGCTGGGCACCGACCGGTCGGGCCTGCTG
GAGGGGCTGGGTGCGGTGTCTCGCGGTGAGGTGCCGGCGGCTGGTGTGGTGCAGGGGGCA
GGCGCGGTCCGCGAGGCGGGCCGGACGGTTCTGGTTTTCCCTGGTCAGGGTTCTCAGTGG
GTCGGTATGGGCGCGGAGTTGATCGCGTCGTCCCCTGCTTTCGCCGAGTCGATGCGGCGG
TGTGCGGAGGCGCTCGCTCCCTTCGTCGATTGGGATTTGCTGGAGGTTGTGTCCGAGGGC
CGTGGGTTGGACCGGGTGGATGTGGTGCAGCCGGTGACGTGGGCGGTGATGGTGTCGCTT
GCGGAGTTGTGGCGGTCGGTGGGCGTTGTGCCAGATGCGGTTTTGGGCCACTCGCAAGGC
GAGATCGCTGCTGCGGTGGTGGCGGGCGCTCTGTCGTTGGAGGACGGGGCGCGGGTGGTG
GCGCTGCGGTCGCAGGTCATCGGCCGCGAGCTGGCCGGACGCGGTGGCATGGCGTCCATC
GCTTTGCCCGAGGCTGAGGTGCGTCAACGCATAGCCAAGACAGCAACGTTGGGCGTGGCC
GCGGTTAATGGTTTGTCCTCGACGGTGGTGTCCGGGGATGCCGATGCGGTTGAGGCGTTC
GTGGTGGCCTGTGAGGCTGATGGGGTTCGGGCGCGTCGTATTGCGGTGGATTACGCGTCG
CATTCGGCGCATGTGGAGGCCATCGAGCAAGAGCTGCTGACCGTCCTGGAGGACGTACGA
CCGCAGGCGGGCAGCGTCCCCTTCTACTCGACGGTCGAGAACGCCTTCCTCGATACCGAG
GCTCTGGATGCCGCGTATTGGTACCGGAATCTGCGGCATCAGGTGCAGTTCGAGGCCGGT
ATTCGGGCGCTGGCCACGGAGGGTTTCACCACCTTTGTGGAGTCCAGCGCACACCCGGTG
CTGACCGTCGGCATTCAGGAGACGCTCGACGATACGGACGCCGAAGCCGTCGTCGCAGGA
TCGCTTCGCCGTGACGAGGGTGGTCTGGAGCGTTTCCTGACCTCGGCCGCCGAGCTGTAT
GTCGCCGGCGTGCCGGTGGACTGGACACCGTTCCTCGCAGGCGAGGGTATTCGTCGCGTC
GACCTGCCGACGTACGCCTTCCAGCGGGAGCGTTTCTGGCTGGAGGTCCCGGCGTCGACG
GCACCGGTGGCGACGGCCCCCCTCGCCGGGGGCGACGTGGTGGATAGCCGTTTCTGGGCG
GCGGTGGAGGCGGAGGACTGGGAGTCGCTGAGCGGGACACTGGCGCTGGCCGGTGATGCG
CCGCTGAGCGCGGTGGTCCCCGCGTTGGCGTCCTGGCGCCGCGAGCGGCAGCGGGCGTCG
ACCGTGCAGAACTGGCGCTACCGCGTGACCTGGAAGCCGGCGCCCGACGCCCGGCGCACG
GCTGCCGTGGACGGCACCTGGCTGGTGGTGGTCCCGACCGGGCATGCCGAGGACGCGGCG
GTGACCGGTGCCGTCGAAGCGCTCGCCGAAGGCGGCGCGTACGTCGAGCAGTTGGAGCTG
AGTGCCGCCGACGCGGACCGTGTGGCCTGGCGCGCCCGTATCGAGGAGTGGCACGCCGCC
GCGCAGCTCGGTGACCGGCCCCTCGCCGGGGTGCTGTCGTTGCTCGCGCTGGACGAGCGG
CCGCACGCCGGCCACGGGGCGATGGCCGCCGGTGTGGCGGGAACGCTGGCGCTGGTGCAG
GCACTGGAGGAAGCGGGCATCGAGGCACGACTGTGGCTGGGGACCCGGGGCGCGGTGTCC
GTCGGGGGCACGGACCAGGTGCTGAGCGCGGTCCAGGCGCAGGTGTGGGGCCTGGGTCGG
GTGGTCGCCCTGGAGCTGCCGGAGCGCTGGGGCGGTCTGGTGGACCTGCCCGAGGCGTGG
GACGGCAGGGCCGGCGCGCGGCTGTGCGCGGTGCTGGCCGGGGCGCTGGACGACGAGGAC
CAGCTCGCGGTGCGGGGCTCAGGGGTCTTCGCCCGTCGTCTCGTCCGGGCTCCGCTCGCG
GCAGCGGGCCGGGCGGACGAGGCCGGTGCGCAGCCCGGGGCGGGAGCGAGCAGCGGTACG
GGTACCGGTGCGCGTACGGGCACCGGCACGGCGACGGACGCCGACGCCGCCTGGCGGACC
CGCGGTACGGCTCTGGTCACCGGAGGCACCGGGGCACTCGGCCCGCACATCGCCCGCTGG
CTCGCGGACAACGGTGCCGAGCACGTGGTGCTCGTCAGCCGGCGCGGCGCCGCCGCACCG
GGCATGGCCGAGCTGCGGGACGAACTCGCCGCCGGAGGCGTCCGGTTGACCGCGTCCGCC
TGCGATGTCGCGGACCGCGACGCGGTCGCCGCGCTCCTGGCCGGGCTCGCGGCGGACGGC
GACACCGTACGTACGGTCATCCACGCCGCCGCCTTCATCGAGCTGGCTGCGCTGACCGAA
GCCGACCCGGCGGAGTTCGCCGACGTGCTCGCCGCGAAGGTCGCCGGCGCGGCCCACCTG
GACGCCCTGCTCGACCCGGACGACCTGGACGCCTTCGTCCTCTTCTCCTCCATCGCCGGC
GTCTGGGGCAGCGGCGACCACGGCGCGTACGCCGCGGCCAATGCCTTCCTGGACGCCCTC
GCCGAACAGCGCCACGCACGGGGCCTGCCGGCCAGCTCCATCGCTTGGGGCGTGTGGGAC
GTATGGGATCCCGAGCGGCTGCCGGAGGGCGTCAAGCCCGAGCAACTCCAGGCCCGCGGG
CTGCCGTTCCTCGACCCGGACACTGCCTTCTCCGCCCTGCGTCAGGTCCTCGCGCACAAC
GAGGCGTGCGTCACCGTCGCCGATGTGGACTGGGACCGCTTCGTTCCGGTCTTCACCTCG
GCGGGACCGCGTCCGCTGCTCGACGGCGTGCCCGAAGCACAACAGGCACTCGACACGGGC
GGCGGTTCCGTGGGCGCGGGCGGTGGCGGTGGCGCCACCGGCGTACCGGCCGACACCTCC
CCGTCGCCGCTGCGCGACCGCCTGTCCGGACTGGCGCCGGCCGAACGCCACGCCGTACTG
CTCGATCTGGTCCGGGCCCAGGCCGCCTCGGTCCTCGGCCATGCCTCGCCCGAGGCCGTC
GCACCCACCCGGGCCTTCCGGGACCTGGGCTTCGACTCGCTCACCGCCGTCGAGCTGCGC
AACCGTCTCAAGAACGCCACCGGTCTGCGCCTCCCGGCCACGCTGATCTTCGACTACCCG
TCTCCCACCGTCCTCGCCGGCTTTCTGCGCGGCGAGATCCTCGGTACGGAGGAGTCCGCG
GCCACGGCCGCCGCGGCGCCGGCCGTTCTTCCGGCGTCCGACGACGACCCGATCGTCATC
GTGGGGATGGCATGCCGCTTCCCCGGCGAGGTCCGGTCCCCGGAGGAGCTGTGGGAGCTG
CTGGAGCGCGGAGGCGAGGCGATCTCGGAGCTGCCGACCGATCGTGGCTGGGACGTGGAG
TCGCTCTACGACCCGGACCCGGAACGACCGGGCAAGACGTACACCCGTCACGGCGGCTTC
CTGTACGACGCGGCGGATTTCGATGCGGGGTTCTTCGGGATTTCGCCGCGTGAGGCGTTG
GCGATGGATCCGCAGCAGCGGTTGCTGCTGGAGACGTCGTGGGAGGCGTTCGAGCGGGCC
GGCATCGACCCGCAGACGCTGCGCGGCAGCAGCACCGCGGTCTTCGCCGGGGTCAGCTAC
CACGATTACGGCTCGCGTCTTCAGGAGGCGCCCGAGGGCGTCGAGGGCTACTTGGGCACG
GGAAACACGGCGAGCATCGCCTCGGGCCGGGTCTCCTACCTCCTGGGGCTGGAGGGCCCC
GCCGTCACGCTGGACACCGGTTGCTCGTCGTCGCTGGTCGCCGTGCATCTGGCCGCGCAG
TCGCTGCGCCAGGGAGAATCCTCGCTGGCGCTCGCCGGCGGCGCGTCCGTCATGGCCGTA
CCCACCTCCTTCACGGAGTTCAGCCGACAGCGCGGGCTGTCCGTCGACGGCCGGTGCCGG
GCGTTCTCGGCGGACGCGGACGGCATGGGCATGGCCGAAGGAGCCGCCATGCTGCTGCTG
GAGCGGCTGTCGGACGCGCGGCGCAACGGCCACCCGGTCCTGGCCGTGGTACGCGGCACC
GCGATGAACCAGGACGGTGCGAGCAACGGCCTCACCGCGCCGAACGGTCCCTCGCAGCAG
CGCGTGATCCGCCAGGCGCTGGCCAACGCCCGTCTGTCGCCGTCCGAGGTGGACGCGGTG
GAGGCGCACGGTACGGGGACCCGGCTGGGCGATCCGATCGAGGCGCAGGCGTTGCTGGCG
ACGTACGGGCAGGGCCGGGCGGAGGACCGGCCGCTGTGGCTCGGTTCGGTGAAGTCGAAC
ATCGGCCACACCCAGGCCGCGGCCGGCGCGGCCGGGGTCATCAAGATGGTCAAGGCCCTG
GAACAAGGGCAGTTGCCTCGAACCCTGCATGCCGCCGAGCCGGCGCCCCAGGTGGACTGG
TCGGCGGGAGCCGTGGAGCTACTGACGGAGGAGCGGGAGTGGCCGTCGTCCCCGGAGCGG
GTGCGGCGGGCCGGTGTCTCGTCGTTCGGGATCAGCGGCACCAACGCACATCTCGTACTG
GAGGAGCCACCGGCCGCGGAGGTCGAGGAGCTGCCTGTGGTGGATGCCCCGGGGGCTTCT
GGGGCGGTTGTGGTGCCGTGGGTGGTCTCGGGGCGTGGCGTGGAGGCGTTGCGGGCGCAA
GCGGGGCGGTTGCGGTCGTTCGTCGGTGCCAGGCCGGAGCTGGGACCGGTTGAGGTGGGG
CGGTCGTTGGCGGTGTCGCGGTCGGCGTTCGAGCGGCGTGCGGTGGTGCTGGGCACCGAC
CGGGGTGCGTTGTTGGGGGCGCTGGGTGCGGTGTCTCGCGGTGAGGTGCCGGCGGCGGGT
GTGGTGGAGGGTGCGGTCCGTGAGGTGGGCCGGACGGTTCTGGTTTTCCCTGGTCAGGGG
TCGCAGTGGGTCGGGATGGGCGCGGAGTTGATCGCGTCGTCTCCCGCTTTCGCCGAGTCG
ATGCGGCGGTGCGCGGAGGCGCTGGCTCCGTTCGTTGACTGGGATTTGCTGGAGGTTGTG
TCCGAGGGCCGTGGGTTGGACCGGGTGGATGTGGTGCAGCCGGTGACGTGGGCGGTGATG
GTGTCGCTTGCGGAGTTGTGGCGGTCGGTGGGCGTTGTGCCAGATGCGGTTTTGGGCCAC
TCTCAAGGCGAGATCGCTGCTGCGGTGGTGGCGGGTGGTCTGTCGTTGGAGGACGGGGCG
CGGGTGGTGGCGCTGCGGTCGCAGGTCATCGGCCGCGAGCTGGCGGGGCGGGGTGGCATG
GCGTCCATCGCTTTGCCTGAACCCGAGGTACGGGACCGACTGAAGTCGCAGACGGGTCTC
GGTCTCGCTGCCGTCAACGGCCCCCTGTCCACCGTCATTTCGGGCGATGCGGCTGCCGTC
GAGGCGTTCGTGGTGGCCTGTGAGGCTGATGGGGTTCGGGCGCGTCGTATTGCGGTGGAT
TACGCGTCGCATTCGGCGCATGTGGAGGCCATCGAGCAGGAGCTGCTGACCGTCCTGAAG
GACGTACGGCCGCAGGCGGGCAGTGTCCCCTTCTACTCAACGGTCGAGAACGCCTTCCTC
GACACCGAGATCCTGGATGCCGCCTACTGGTACCGGAACCTGCGGCATCAAGTGCAGTTC
GAGGCCGGTATTCGGGCGCTGGCGGCGGACGGTTTCACCACGTTCGTGGAGTCCAGCGCA
CACCCGGTGCTGACCGTCGGCATTCAGGAGACGCTCGACGATACGGACACCGAAGCCGTC
GTCACAGGATCACTTCGCCGTGACGAAGGTGGGCTGGAGCGTTTCCTGACCTCGGCCGCC
GAGCTGTACGTCACCGGTGTACCGGTCGACTGGACGCCGTTCCTTGCAGGTGAAGGCACC
CGGCCCGTCGACCTGCCGACTTATGCCTTCCAGCGTGAGCGCTTCTGGCTGGAAGCCTCC
GCTTCGGCTGCCGGTGACATGGCGGCTGCCGGGCTGACGACTGCGAGCCATCCGTTGTTG
GGGGCGGCGGTTGAGGTTGCCGGGTCGGATGAGGTGTTGTTCACCGGGAGGTTGTCGCTG
GAGTCGCATCCGTGGCTGGCGGATCATGCGGTGGCCGGGACGGTGTTGTTGCCGGGTACG
GCGTTTGTGGAGCTTGCGGTGCGTGCCGGCGACGAGGTTGGTTGCGGGCAGGTGGAGGAG
CTGGCGTTGGAGGCTCCGCTGATCGTGCCGGAGCGTGGCGGTGTCGCCCTCCAACTCGGA
CTCGGTGCCGCCGACGACTCCGGACGCCGGGCCTTGAGCATCTATTCGCGTGCGCCGGGC
GACGAGCGCGGCCCCTGGACGCGGCACGCCACCGGCACGCTGGCCTCCGCCGGCGTCGCA
GAGACCGCCGACGTCCCGGCCGGGACGGACCTGGCGGTGTGGCCCCCGGTGGGAGCGGAA
CCGATCGGGATCGAGGGCTACTACGACCGGCTCGCCGCGCAGGGATACGGATACGGCCCG
GCCTTCCACGGGCTGCGGGCGGCCTGGCGGCGCGGCGACGAGCTGTTCGCCGAGGTCCAG
CTGCCCGAGGCGGTAGCGGCGGACGCGGCGGCCTTTGGCCTGCACCCCGCCCTGCTGGAC
GCCGCCCTGCACACGCTGGGCCTCGGAGCGGTGCCCGACGTGGGTGAGGGACGGGCGCGT
CTGCCGTTCTCCTGGAGCGGGGTGTCGCTCCACCGGACGGGTGCCGCCGGGCTCCGCGTA
CGGGTCACGCCGCTGGACCAGGACACCGTCGCGGTGACGGTCGCCGACCCCACGGGTGCA
CCGGTGGCGTCGATCGAGTCACTGGTCACCCGGCCGGTCTCCACCGAGTCGCTCAGGGCC
GCGAGTTCGCCCGTGCGCGACGCGATGTTCGCGGTGGACTGGCACCAGCTCCCGGCGGCC
GGCAGCGCGGCTCCCGTGCGTCATTGGGCCGTCCTGGGAAGTGGCGAGGGGGCGGACGTC
ACAGACGGGGCGGCCGCGGGACACGTGGCCGGTCTGGTCAGCGCGCTGGAGCGTTCCGGC
GGGACCGTGTCCTGCCACGCCGACCTGGCCGCTCTCGCTGCCGCCCAGTCGCAGTCGCCG
CACGACGTTCCCGACGTCGTGGTCCTCCCGTGCCTCGCGGGGGACCGCGAGGCCGCCGGG
CTCGCCGAGGCCACCCATGACGCGCTCCGCCGGGTTCTCGGAGTGGTGCAGGCATGGCTG
GACGATGAGCTTTTCGCCTCGTCGCGGCTGGTCGTGCTCACCCGAGGTGCGGTCGCGACC
ACACCCGACGAAACGGAGCTAGACCTTCCGCATGCCGCCGTGTGGGGTTTGTTGCGGTCG
GCGCAGTCGGAGCATCCGGACCGGTTCGTGCTGGTGGACGTGGATACAGCCATGGACACG
GACATGGACACGGACATGGACACGGACATGGACACGGACATGGACACGGCCGTGGACTCG
GGCACGGACTCGGGCGTGGAGTCGGACGCGGGTATGGGCTCCGTGCGGGTGTTGGGTTCG
GTGGTGGCGTGTGGGGAGCCGCAGGTTGCGGTGCGTGGGGGAGTGTTGTGGGTGCCTCGT
GTTGTTCGGGCGCGGGTGCCGGTGGTGGGTGCGCAGGGTGGTGTGTGGGGCGAGGGTGCG
GTGCTGGTGACGGGTGCCAGTGGTGTGCTGGCGGGTGTGGTGGTGCGGCACTTGGTGAGT
GCCTGTGGGGTGCGTCGTGTGGTGTTGGTGTCGCGTCGTGCTGCTGAGCAACTAGCCGCT
GAGGTACGTGAGTTGGGTGCCGATGCGGCGTTGGTGGCGTGTGATGTGGCGGATCGTGGT
GTGTTGGCGGGGGTGTTTGCTGCGCATCGGATTTCGGCTGTGGTGCATGCGGCGGGTGTG
TTGGATGACGGTGTGGTGGGGTCGTTGTCGCCGGAGCGGGTGGGGGGTGTGCTGCGGCCG
AAGGTGGACGGGGCGGTGGTGTTGGATGAGGTGTCGCGGGGTGTGGATCTGAAGGCGTTT
GTGCTGTTTTCTTCTGCGGCGGGGACGTTGGGTGGTCCGGGGCAGGGGAGTTATGCGGCG
GCGAATGCGTTTTTGGACGCGTTGGCGCAGCGGCGTCGAGCGCTCGGCCTGCCCGCCACC
TCCCTCGGCTGGGGCTTCTGGGAGGAGCGCAGCGGGCTGACCGGCCACCTCGGCCGTGCC
GACCTGAACCGCATGTCGCGGGTGGGCATCGCTCCGATGACCTCGCAGGAAGGGCTGGCC
CTGTTCGACGCGGCCTGCGCGACGGACGAACCGATGCTGCTGCCGATGCGGCTGGAGACC
TCCGCGCTGCGTGCGCTGGCCGCGTCCGGCACCGTGCCGCCGCTGCTCAGCGCGCTGGTA
CGGACTCCGGTCCGCCGTACCGCGGCGGACGGCGGGGGCGCGGCGAACGGCGCGGAGTCG
TTGCAGGAGCGGCTCAGCAAGGTCTCCGCGGCGGAGCGGGCGGGTGCGCTGGAAGATCTG
GTCGTCGCGCAGGTGGCGTCCGTACTGGGGCACGCCTCCGTGGCGGCGGTCGAGCCCGGC
CGTCCGTTCAAGGAGCTGGGCTTCGACTCGCTGACCGCGGTCGAGCTGCGCAACCGTCTC
AAGAACGCCACCGGGCTGCGCCTGCCGGCCACCCTCGTGTTCGACCATCCGACGCCCGAG
GCCGTCGCCGCCCACCTGGGGGCCAAGCTCTTCCCTGAGGCGGCGAACACCGCACCGGAT
GCTGGCGCACCGGACATCGATCACCTCGTCAGCCTCGCCCTCGACGGCAAGGACGGCTGA
[4] KS51..426
[4] AT590..905
[4] methylmalonyl-CoA778..782
[4] KR1262..1442
[4] ACP1560..1630
[5] KS1656..2031
[5] AT2193..2508
[5] methylmalonyl-CoA2381..2385
[5] DH2557..2725
[5] KR3099..3270
[5] ACP3377..3447
[4] KS151..1278
[4] AT1768..2715
[4] methylmalonyl-CoA2332..2346
[4] KR3784..4326
[4] ACP4678..4890
[5] KS4966..6093
[5] AT6577..7524
[5] methylmalonyl-CoA7141..7155
[5] DH7669..8175
[5] KR9295..9810
[5] ACP10129..10341

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [585-710]  G3DSA:3.40.366.10 [778-895]  G3DSA:3.40.366.10 [2187-2313]  G3DSA:3.40.366.10 [2381-2498]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR006162 Phosphopantetheine attachment site (PTM)
 [1588-1603]  PS00012 [3405-3420]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1560-1630]  PS50075 [3377-3447]  PS50075
PS50075   ACP_DOMAIN
 [1560-1633]  2.29999999999998e-47 G3DSA:1.10.1200.10 [3376-3450]  2.29999999999998e-47 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1563-1628]  4.3e-11 PF00550 [3381-3446]  8.60000000000001e-13 PF00550
PF00550   PP-binding
 [1553-1672]  6.19998763505952e-29 SSF47336 [3369-3464]  1.89999859865865e-25 SSF47336
SSF47336   ACP_like
IPR013968 Polyketide synthase, KR (Domain)
 [1262-1440]  1.5e-60 PF08659 [3099-3269]  4.6e-48 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [51-301]  4.40000000000003e-97 PF00109 [1656-1906]  2.39999999999997e-96 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [309-426]  3.7e-47 PF02801 [1914-2031]  1.99999999999999e-47 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [590-905]  6.20000000000009e-102 PF00698 [2193-2508]  3.19999999999996e-102 PF00698
PF00698   Acyl_transf_1
IPR015083 Polyketide synthase, docking (Domain)
 [20-44]  6.50000000000001e-11 PF08990
PF08990   Docking
 [16-51]  2.39999798157265e-09 SSF101173
SSF101173   Polyketide_synth_docking
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [588-877]  1.70000295590053e-63 SSF52151 [2191-2490]  1.79999754022375e-63 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [713-777]  3.1999989904635e-16 SSF55048 [2316-2380]  2.2999993566538e-16 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [53-313]  G3DSA:3.40.47.10 [314-480]  G3DSA:3.40.47.10 [1658-1918]  G3DSA:3.40.47.10 [1919-2084]  G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [43-425]  3.99998544139406e-104 SSF53901 [1648-2030]  6.10002656149838e-106 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1261-1478]  7.10000000000008e-61 G3DSA:3.40.50.720 [3100-3269]  1.2e-62 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [214-230]  PS00606 [1819-1835]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [592-886]  1.59998835313644e-117 SM00827 [2195-2489]  7.29994178862692e-117 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1561-1633]  1.90000694315261e-35 SM00823 [3378-3450]  2.99998750445706e-36 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [2557-2725]  7.00003808422647e-89 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [53-480]  SM00825 [1658-2085]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1262-1442]  1.70000295590053e-52 SM00822 [3099-3270]  1.40000506907309e-44 SM00822
SM00822   PKS_KR
SignalP No significant hit
TMHMM No significant hit