close all open/close all

CDS information : Strply_00310


close this sectionLocation

Organism
StrainNRRL 2433 (=NBRC 13058)
Entry nameStreptolydigin
Contig
Start / Stop / Direction75,380 / 56,865 / - [in whole cluster]
75,380 / 56,865 / - [in contig]
Locationcomplement(56865..75380) [in whole cluster]
complement(56865..75380) [in contig]
TypeCDS
Length18,516 bp (6,171 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)polyketide synthase type I
Gene
Gene (GenBank)slgA1
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[19875077] Deciphering biosynthesis of the RNA polymerase inhibitor streptolydigin and generation of glycosylated derivatives. (Chem Biol. , 2009)

close this sectionPKS/NRPS Module

0 malonyl-CoA
1 methylmalonyl-CoA
2 malonyl-CoA
3 methylmalonyl-CoA
KSQ29..394
AT559..870
ACP954..1032
KS1069..1445
AT1610..1925
KR2240..2418
ACP2524..2594
KS2622..2999
AT3208..3519
KR3807..3985
ACP4096..4166
KS4199..4576
AT4743..5062
DH5111..5302
KR5693..5891
ACP6014..6084

close this sectionSequence

selected fasta
>polyketide synthase [polyketide synthase type I]
MRACEERGLGIMSIVPGGITESGPISEGAIAVVGLACRLPQAPDPQAFWQLLKEGRSAVG
EVPHDRWDADTLTGPARHGAFLDRVDGFDAAFFGISPREAAMMDPQQRLVLELAWEALED
AGILPESVRGTRTGVFFGAMWDDYATLLHRRGLSAVTQHSVTGLHRSIIANRVSYALGLR
GPSLTVDTAQSSGLTAVHLACESLRSGASEIALSGGVNLNIVPESAFGAERFGGLSPDGR
CYTFDERANGYVRGEGGGVVLLKPLARALADGDPVYCVIRGSAMNNDGATDGLTVPNPQA
QQDVLRLAYEAAGVDPAQVQYVELHGTGTKVGDPVEASALGAVLGTADGRERPVAVGSAK
TNVGHLEGAAGIVGLLKVALSLRHGQLPASLNYEQPNPRIALDEWNLRVQRSLTDWPAAG
AGALPLAGVSSFGMGGTNCHVVLEGAPEGVRAGDDGEPGGPASAEAAGPLPWVLSATDTA
ALRAQAERLRSFVAARPETPPADVALTLATSRTAFAHRAVVLGQDTDALLNNLTAVSNGQ
ASPGVVEGCVSGGSGRVGFLFSGQGSQRVGMGRVLYGAFPVFAAAVDEVCGAFDGVLGGS
LREVMFAEGVGAEGVLERTEFAQPALFAVEVGLFRLVESWGVRADFVAGHSVGELAAAFV
AGVWSLADAVRVVAARGRLMQALPGGGAMVSLVASEGEVAPLVAGRAGEVGVAAVNGPSS
VVVSGVEGAVGEVAAHFEALGRRVRRLRVSHAFHSPLMDPMLEEFGGVVRSVEFSRPRLG
MVAGEGVCDPEFWVRHVRDAVRFADQISWLENAGVSTFVEMGPGGVLTAMTRECVTRPDA
LLVPMLRKGFAEDRAVAKALAELHVRGVRVNWEAFLEGNGHRGRRTTLPTYAFQRERHWL
PDLEKSANTEKAPESDRAGETPKAQDTGKVPDTEEAPRVERQELSLAERVAAAPREDAER
LLREVVRVQVAVVLGHDSADTVKMESRFKELGCDSLMAVELCSRLGDATGQRLPASLTFD
HPTPNAVVSHLLAEMRRGQDLEPVTETAAGDTVVPQVSAGSEADPAEDDPIAIVSMACRF
PGGIASPEDLWRLVAEGGDAISVFPADRGWDVAALYDADPEHSGTSYVREGGFLHEAAEF
DPAFFGISPREALAMDPQQRLLLETSWEAFERAGIVPRSLRGSRTGVFVGATAQDYGPRL
HEAADGAEGYALTGTTASVLSGRLSYTFGLEGPAVTVDTACSSSLVALHLAVRALRQGEC
TLALASGATVMSHPGMFVEFSRQRGLAADGRCKAFAAGADGTGWAEGVGVLVLERLSDAR
RNGHEVLAVVRGTAVNQDGASNGLTAPNGPSQQRVIRQALADARLSPSEVDVVEAHGTGT
RLGDPIEAQALLATYGQGRAEGRPLWLGSLKSNVGHTQAAAGVGGVIKMVMALRQGVLPR
TLHVDAPSPHVDWSAGAVELLTEEREWPSEAGRVRRAGVSSFGVSGTNAHAIIEQAPAAE
AEEMPAVDAPHSDELAASASVVVPWVVSGRGEGALRAQAERLRSFVEARPELGPVEVGRS
LAVSRSAFERRAVVLGADRGALLGALGALSAGREAAGVVEGAVREVGRTVLVFPGQGSQW
VGMGAELIASSPAFAESMRRCAEALAPFVDWDLLEVVSEGRGLDRVDVVQPVTWAVMVSL
AELWRSVGVVPDGVVGHSQGEIAAAVVAGGLSLEDGARVVALRSQVIGRELAGRGGMASI
ALPAAEVRQRVGDVPELGVAAVNGPSSTVVSGDADAVEAFVVACEADGIRARRIAVDYAS
HSAHVEAIEQELLTVLEDVRPQAGRIPFYSTVENAFLDTEVLDAAYWYRNLRHQVQFEAG
IRALAAEGFTTFVESSAHPVLTVGIQETLDDTDTEAVVTGSLRRDEGGLERFLTSAAELY
VAGVPVDWTPFLADEGVRRVDLPTYAFQRERFWLEAPVPTAGEATAVDTRFWAAVEAEDW
EALRGELALEGDAPLSAVLPALASWRREQQRTSAVDSWRYRVVWKPVAVEGSVPVVAGRW
LVVVPAGFESDAAVMGVVAALEERGVEVRRVVIEGAAAGRSEVADQLRAVVTDDVSGVAE
DPGTGVGVVGVVSLLALAGGGAVSAVVLVQALGEVGVEAPLWVVTRGAVGVGGSDRVLSA
VQSQVWGVGRVAALELPERWGGLVDVPEGWDSRAGAGLCALLGGALAGEDQVALRSSGVW
VRRVARAGGGGSAGVWCPRGTVLVTGGTGALGRRVALWAARRGAERVVLASRSGAGASGL
ESVEAEFAALGVELEVAACDVADRGAVAELLGSLPGLSAVVHAAGVLDDGVLEGLSPERV
AGVLRAKADAAAVLDELTRDLTPDLDAFILFSSVVGTLGRAGQANFAAANAFLDALAQQR
QDLGLPATSVAWGPWNAGGAAGGAVGEELRKRGLPALDADLALTAMAQAVGRGEAAVMVA
DVDWERFVPAFTATRPSPLLADLPEVRTSATASASAGSGEGDGTASSLAQRMAGRPAAEV
EHLLLDLVRTQAAAVLGHASADAIGETHAFKDLGFDSLTAVEFRNRLKNATGLRLAPTLV
FNYPTPKALARHLYGEIAGAEEWQSASTAVAPVAALPAVEDDPIVIVSMACRFPGGVSSP
EDLWRLVAEGGDAISVFPADRGWDVEALYDADPDHAGTSYVREGGFLYGAAEFDAGFFGI
SPREALAMDPQQRLLLETSWEAFERAGINPDGLRGSRAGVFMGVVSQDDYGPRMSEAPEE
FEGYLLTGTAASVVSGRLSYTFGLEGPAVTVDTACSSSLVALHLAAQSLRQGECSVALAG
GATVMSTPGTFVEFSRQRGLAVDGRCKAFAAGADGTGWGEGVGVLVLERLSDARRNGHEV
LAVVRGTAVNQDGASNGLTAPNGPSQERVIRQALAQARLTPDQVDVVEAHGTGTRLGDPI
EAQALLATYGQGRAEGRPLWLGSLKSNVGHTQAAAGVGGVIKMVMALRQGVLPRTLHVDA
PSPHVDWSAGAVELLTEERAWPAEAGRVRRAGVSSFGVSGTNAHAIIEQAPGHEVPVDEA
PVDEAAAHKTSAVEAPQPDELGKSVDVAEPVDVAEPIGVGESDELRGNGEQGASDPAVLP
WLIAGRSAGALRAQAERLRSHVAARPELEPVDVAFTLATTRAAMDHRAVVLAADRPRLLD
SLTAITQGETPAGVVEGCVSGGSGRVGFLFSGQGSQRVGMGRVLYGAFPVFAAAVDEVCG
AFDGVLGGSLREVMFAEGVGAEGVLERTEFAQPALFAVEVGLFRLVESWGVRADFVAGHS
VGELAAAYVAGVWSLADAVRVVAARGRLMQALPGGGAMVSLVASEGEVAPLVAGRAGEVG
VAAVNGPSSVVVSGAEGAVGEIAAHFEALGRRVRRLRVSHAFHSPLMDPMLEEFGRVVRS
VEFSRPRLGMVAGEGVCDPEFWVRHVRDAVRFADQISWLENAGVSTFVEMGPGGVLTAMT
QDCVTRPDALLVPMLQKNLPEDHAILQALAELHVGGVAVDWDAFFAERGGRRVELPTYAF
QRQHYWLDGASGRRERERDRDAGRGEGLGQGESQGRTSRSPADSWRYRVMWKPVAVEGSV
PVVAGRWLVVVPAGFESDAAVMGVVAALEERGVEVRRVVIEGAAADRSEVADQLRAVVTD
DVSGVAEDPGTGVGVVGVVSLLALAGGGAVSAVVLVQALGEVGVEAPLWMVTRGAVGVGG
SDRVLSAVQSQVWGVGRVAALELPERWGGLVDVSEGWDSRAGAGLCAVLGGALAGEDQVA
LRSSGVWVRRVARAGGGGSAGVWCPRGTVLVTGGTGALGRRVALWAARRGAERVVLASRS
GAGASGLESVEAEFAALGVELEVAACDVADRGAVAELLGSLPGLSAVVHAAGVLDDGVLE
GLSPERVAGVLRAKADAAAVLDELTRELTPDLDAFILFSSAAGVLGNEGQANYSAANAFL
DALAQQRQDLGLPATSVAWGAWAHSGMAMDDAASQQLHRTGFLEMDPEQALTEMAQAVGR
GEAAVMVADVDWERFVPAFTAARPSPLLADLPEVREVSAASAALPGASGAAETRHDAGSL
AERLAGLPRAEQRDHLLQVVRTQAATVLGHAGPQAIDPGRAFKDLGCDSLGAVRLRNRLN
AATGLRLPASVVYDYPTAGDLTGYLLGVYAGAETETEEGAPTADGIMAGALGTPAPAADE
PIAIVSMSCRFPGGVGSPEDLWELLAGGGDGLSAFPAERGWDLDALYDPDPDRSGTSYVR
EGGFLDDVDRFDAAFFGINPREALAMDPQQRLLLETSWEAFERAGIDPRSLRGSKTGVFV
GSNGQDYATLLRQDPGAVEGYLGTGIAASVASGRVSYTFGLEGPAVTVDTACSSSLVALH
LAAQSLRQGECTLALAGGVTVMTTPEVFVEFSRQRGLAADGRCKAFAAGADGTGWGEGVG
VLVLERLSDARRNGHEVLAVVRGTAVNQDGASNGLTAPNGPSQQRVIRQALAQARLTPDQ
VDAVEAHGTGTTLGDPIEAQALLATYGQGRAEDRPLWLGSVKSNIGHTQAAAGAAGVIKM
VMALRQGVLPRTLHVDAPSPHVDWSAGAVELLTEERAWPAEAGRVRRAGVSSFGVSGTNA
HAIIEQAPAAEAEETPSVDAPHSDELAASASVVVPWVVSGRGEGALRAQTERLRSFVEAR
PELNPTDVGFSLALRAPMENRAVVLAAGRSGLLEGLGAVSRGEVPAAGVVQGAGAVREAG
RTVLVFPGQGSQWVGMGAELIASSPVFAEWMRRCAEALAPFVDWDLLEVVTEGRGLDRVD
VVQPVTWAVMVSLAELWRSVGVVPDAVLGHSQGEIAAAVVAGALSLEDGARVVALRSQVI
GRELAGRGGMASLALPEAEVRDRLKTQTGLGIAAVNGPRSTVISGDAEAVESFVSSCETE
GIRARRIAVDYASHSAHVEAIEQELLTVLEGVRPQAGSVPFYSTVEDAFLDTEVLDAAYW
YRNLRRQVQFEAGIRALAADGFTTFVESSAHPVLTVGIQETLDDTDAEADTEAVVAGSLR
RDEGGLERFLTSAAELYVAGVPVDWSSFLGGEGARRVELPTYAFQGRRYWPRTAPAKSAD
ALSFGLGSTRHPLLGAAVEVAGSDEVLFTGRLSLESHPWLADHAVAGTVLLPGTAFVELA
VRAGDEVGCGQVEELALEAPLIVPERGGIALQLGLGAADDSGRRTLTLHSRAAEDGDGPW
TRHATGTMAPAGAPASGEAPDPADSASPVAATETALTDQTALTDKTDLTVWPPAEAVPVP
VDDAYERLAALGVDYGPAFHGLRAAWRRGDELFAEVQLPEAVAADAAAFGLHPALLDAAL
QPLGLGTLFPEPEPGYSRRPFVWSGVRLHATGADALRVRVIRTGEEAVSVVVADAKGETV
ATVDTLTFRQVSDEGPSPATGTHHDSLFRYEWVPVAVPRAEFRPAPAGARWVVLSTGPDG
YADPTALGDVLGGGDDVPELVFAPMTRARAGIEEVAGLQETDGLQEADGLRETDGLQGTD
ENVAEAVRAAAHRALELVQAWLADERSEASRLVIVARQDLVGAPVWGLVRSAQVENPGRF
VLLETDGAHAEERPAAGAAAPWEAMAAAVATGEPQLRLCAGEVTAARLVRAAAPPAGTRA
DVIPDTASDATVDATATTHVTVDTSPDAAPDAASDVSPDGTSAAVGAAFDPNGTVLVTGA
SGGLARLLARHLVVERGVRHLLLTSRRGPAADGMPELAAELTELARAAERARAAGPAGAA
LSDPSVEVVACDVADRAQLAKVLAAVPADRPLTAVVHTAAELDDGVVHALNPERIDRVLR
PKVDGALNLHALTAHLDLSAFVLFSSLSGTLGGAGLANYSAANAFLDALARHRRAHGLPA
VSLAWGLWEQRSGMAGRLSDVDLARMSRVGAAPMPAEEGLALFDAATAYGAAYGEPVVVP
ARLDTAELRSQAAAGVLPPLFRSVVRTVPVRRSLAASGAQGTEGADGAAGAEEPGSALAA
RLAGVARSEQDRLLLELVREQAASVLGHPSTDEVQGNRAFKDLGLDSLTAVELRNRLKRA
TGLRLAPTLVFDYPTPVALAQRLRTELVPDGPENEPAVLADLERLEAALSDVASDDSVRD
KVAARLQALLWRWEDSRSAGSEQQSTEEKQEFDPSSDEEMFALIDEEFGDL
selected fasta
>polyketide synthase [polyketide synthase type I]
GTGAGGGCCTGCGAAGAGCGAGGGTTGGGAATCATGTCGATTGTCCCCGGTGGCATCACC
GAAAGCGGTCCGATTTCCGAGGGGGCCATCGCCGTCGTCGGATTGGCGTGCCGACTTCCC
CAGGCGCCGGACCCGCAGGCTTTCTGGCAGTTGCTCAAGGAAGGCCGTAGCGCGGTCGGC
GAGGTGCCCCACGACCGGTGGGACGCGGATACTTTGACGGGCCCGGCCCGGCACGGTGCT
TTTCTCGACCGGGTCGACGGGTTCGACGCCGCATTCTTCGGCATCTCCCCGCGTGAAGCG
GCGATGATGGACCCGCAGCAGCGACTGGTGCTCGAACTCGCCTGGGAGGCCCTTGAGGAC
GCGGGAATCCTTCCGGAGAGTGTGCGCGGCACCCGTACCGGAGTGTTCTTCGGCGCGATG
TGGGACGATTACGCAACGCTGCTGCACCGGCGCGGACTTTCCGCCGTCACCCAGCATTCC
GTGACCGGCCTGCACCGCAGCATCATCGCCAACCGCGTCTCCTACGCACTCGGGCTGCGC
GGCCCCAGCCTTACCGTCGACACCGCCCAGTCATCCGGCCTCACCGCCGTTCACCTGGCG
TGCGAAAGCCTGCGCAGCGGCGCCAGCGAGATCGCCCTCTCGGGCGGGGTGAACCTCAAT
ATCGTTCCGGAAAGCGCTTTTGGCGCGGAGCGGTTCGGCGGCCTTTCCCCCGACGGTCGC
TGCTATACGTTCGACGAGCGGGCGAACGGATATGTGCGCGGTGAGGGCGGCGGCGTCGTC
CTGCTCAAGCCGCTCGCCCGTGCGCTCGCGGACGGCGACCCGGTCTATTGCGTCATCCGC
GGCAGCGCCATGAACAACGACGGCGCCACCGACGGTCTCACCGTGCCGAATCCGCAGGCC
CAGCAGGACGTACTGCGGCTCGCCTATGAGGCGGCCGGCGTCGACCCGGCGCAGGTGCAG
TACGTCGAACTCCACGGCACCGGTACCAAGGTCGGCGACCCCGTCGAAGCCTCCGCGCTC
GGCGCGGTGCTGGGCACCGCCGACGGCCGGGAGCGGCCCGTCGCCGTCGGCTCCGCGAAG
ACCAACGTCGGCCACCTGGAGGGCGCCGCCGGGATCGTCGGGCTGCTGAAGGTCGCCCTG
TCGCTCCGGCACGGACAGCTCCCGGCCAGCCTCAACTACGAGCAGCCCAACCCCCGCATT
GCCCTGGACGAGTGGAACCTCCGGGTCCAGCGGTCCCTGACGGACTGGCCCGCGGCCGGC
GCCGGCGCGCTGCCGCTGGCCGGCGTCAGCTCGTTCGGCATGGGTGGCACCAACTGCCAT
GTCGTGCTGGAGGGGGCACCCGAAGGCGTACGAGCCGGCGACGACGGCGAGCCGGGCGGC
CCCGCCTCCGCCGAGGCCGCCGGACCGCTGCCGTGGGTGCTGTCGGCGACGGACACCGCC
GCGTTGCGGGCCCAGGCGGAACGGCTGCGCTCGTTCGTGGCGGCCCGGCCCGAGACGCCC
CCAGCCGACGTGGCGCTGACGCTGGCCACGTCCCGTACCGCCTTCGCGCACCGGGCAGTG
GTGCTCGGCCAGGACACGGACGCCCTGCTGAACAACCTCACCGCGGTGTCCAACGGCCAG
GCGTCACCCGGTGTTGTTGAGGGGTGTGTGTCGGGTGGTTCTGGGCGTGTGGGGTTTTTG
TTTTCTGGTCAGGGGTCGCAGCGGGTGGGGATGGGGCGTGTTCTTTATGGGGCGTTCCCG
GTTTTTGCTGCGGCGGTGGATGAGGTGTGTGGGGCTTTTGACGGTGTGTTGGGTGGGTCG
CTGCGTGAGGTGATGTTTGCGGAGGGGGTGGGTGCTGAGGGGGTTTTGGAGCGTACGGAG
TTTGCTCAGCCGGCGTTGTTTGCGGTTGAGGTGGGGTTGTTTCGGTTGGTGGAGTCGTGG
GGGGTGCGGGCTGATTTTGTTGCGGGTCATTCGGTGGGGGAGTTGGCGGCTGCGTTTGTG
GCGGGTGTGTGGTCGTTGGCTGATGCGGTGCGGGTGGTGGCTGCGCGGGGTCGGTTGATG
CAGGCGTTGCCTGGTGGTGGGGCGATGGTGTCGTTGGTGGCGTCGGAGGGTGAGGTGGCG
CCGCTGGTTGCTGGTCGTGCGGGTGAGGTGGGTGTGGCGGCGGTGAATGGTCCGTCGTCG
GTGGTGGTGTCGGGTGTTGAGGGTGCGGTGGGGGAGGTTGCCGCGCATTTTGAGGCGTTG
GGGCGGCGGGTGCGTCGTTTGCGGGTGAGTCATGCGTTCCATTCGCCGTTGATGGATCCG
ATGTTGGAGGAGTTTGGTGGGGTGGTGCGGTCGGTGGAGTTTTCTCGGCCGCGGTTGGGG
ATGGTGGCTGGTGAGGGGGTGTGTGATCCGGAGTTTTGGGTGCGGCATGTGCGGGATGCG
GTGCGGTTTGCGGATCAGATTTCCTGGTTGGAGAACGCGGGTGTCTCGACGTTTGTGGAG
ATGGGCCCGGGCGGCGTACTGACCGCCATGACACGGGAGTGCGTCACCCGGCCTGACGCT
CTCCTCGTGCCGATGCTGCGTAAAGGTTTTGCCGAGGACCGGGCAGTGGCCAAGGCGCTG
GCCGAATTGCACGTCCGAGGCGTGCGGGTGAACTGGGAAGCGTTCCTTGAGGGAAACGGG
CACCGTGGTCGTCGCACGACCCTGCCGACCTACGCATTCCAGCGCGAGCGCCACTGGCTG
CCGGACCTCGAAAAGTCTGCGAATACTGAAAAGGCTCCGGAGAGCGATAGGGCTGGGGAA
ACCCCGAAGGCTCAGGACACCGGCAAGGTCCCGGACACCGAAGAGGCCCCGCGCGTCGAG
CGGCAGGAACTGAGTCTTGCCGAACGGGTCGCCGCGGCACCGCGCGAGGACGCCGAGCGC
CTGCTTCGTGAGGTCGTACGCGTCCAGGTCGCCGTCGTCCTGGGACATGACAGCGCCGAC
ACCGTCAAAATGGAGAGCCGGTTCAAGGAACTCGGGTGTGACTCCTTGATGGCGGTGGAG
CTCTGCAGCCGACTCGGCGATGCCACGGGACAGCGTCTGCCCGCGAGCCTCACCTTCGAC
CACCCGACCCCGAATGCCGTGGTCAGTCACCTGCTGGCGGAAATGCGCCGCGGCCAGGAC
CTGGAACCGGTGACGGAAACCGCAGCCGGGGACACGGTCGTGCCGCAGGTGAGTGCTGGC
TCCGAGGCCGATCCGGCCGAGGACGACCCGATCGCCATCGTGTCGATGGCCTGCCGCTTT
CCGGGGGGAATTGCGTCGCCGGAGGACCTGTGGCGGCTCGTCGCGGAGGGCGGGGACGCG
ATTTCGGTGTTCCCGGCGGACCGTGGTTGGGATGTGGCGGCGCTGTACGACGCGGACCCG
GAGCACTCGGGCACCTCGTATGTACGCGAGGGCGGTTTCCTGCACGAGGCGGCGGAGTTC
GATCCGGCGTTCTTCGGGATTTCGCCGCGTGAGGCGTTGGCGATGGATCCGCAGCAGCGG
TTGCTGCTGGAGACGTCGTGGGAGGCGTTCGAGCGGGCCGGCATCGTGCCACGGTCGCTC
CGCGGCTCCAGGACCGGGGTCTTCGTGGGCGCGACCGCCCAGGATTACGGCCCCAGGCTG
CACGAGGCGGCCGACGGAGCCGAGGGCTACGCACTGACGGGCACGACCGCGAGCGTGCTG
TCGGGCCGGTTGTCGTACACGTTCGGGCTGGAGGGGCCGGCGGTGACGGTGGACACCGCG
TGCTCGTCGTCGCTGGTCGCCCTGCACCTGGCCGTGCGGGCGCTCCGGCAGGGCGAGTGC
ACGCTCGCGCTGGCGAGCGGCGCGACGGTGATGTCCCACCCCGGAATGTTCGTCGAGTTC
AGTCGTCAGCGGGGATTGGCGGCGGACGGCCGGTGCAAGGCGTTCGCGGCCGGTGCGGAC
GGCACCGGGTGGGCTGAAGGCGTCGGTGTGCTGGTGCTGGAGCGCCTGTCGGACGCGCGC
CGTAACGGTCATGAGGTCCTGGCGGTGGTGCGGGGTACGGCGGTGAACCAGGACGGTGCG
AGCAACGGCCTGACGGCCCCGAACGGTCCCTCGCAGCAGCGGGTGATCCGGCAGGCGCTG
GCCGACGCCCGTCTGTCGCCGTCCGAGGTGGATGTGGTGGAGGCGCACGGTACGGGGACC
CGGCTGGGTGATCCGATCGAGGCGCAGGCGTTGCTGGCGACGTACGGGCAGGGGCGGGCG
GAGGGGCGGCCTCTGTGGTTGGGGTCGTTGAAGTCGAATGTGGGGCATACGCAGGCTGCT
GCGGGTGTCGGTGGTGTCATCAAGATGGTGATGGCGTTGCGGCAGGGTGTGTTGCCGCGG
ACGTTGCATGTGGATGCGCCGTCGCCGCATGTGGACTGGTCGGCGGGTGCGGTGGAGTTG
CTGACGGAGGAGCGGGAGTGGCCTTCGGAGGCCGGCCGGGTGCGTCGTGCCGGCGTGTCG
TCCTTCGGCGTGAGCGGGACGAATGCCCACGCGATCATCGAGCAGGCGCCGGCCGCGGAG
GCCGAGGAGATGCCGGCCGTTGACGCCCCTCACTCCGATGAGCTCGCGGCTTCCGCGTCG
GTTGTGGTGCCGTGGGTGGTCTCGGGGCGTGGTGAGGGCGCGTTGCGGGCGCAGGCGGAG
CGGTTGCGGTCGTTCGTCGAGGCGAGGCCGGAGCTGGGACCGGTTGAGGTGGGGCGGTCG
TTGGCGGTGTCGCGGTCGGCTTTCGAGCGGCGTGCGGTGGTGCTGGGCGCTGACCGGGGT
GCGTTGCTGGGCGCGTTGGGCGCGCTGAGTGCGGGCCGTGAGGCGGCGGGTGTGGTGGAG
GGTGCGGTCCGTGAGGTGGGCCGGACTGTTCTTGTTTTCCCTGGTCAGGGTTCGCAGTGG
GTTGGGATGGGCGCGGAGTTGATCGCGTCGTCTCCCGCTTTCGCCGAGTCGATGCGGCGG
TGTGCGGAGGCGCTGGCTCCGTTCGTTGACTGGGATTTGCTGGAGGTTGTGTCTGAGGGC
CGTGGGTTGGACCGGGTGGATGTGGTGCAGCCGGTGACGTGGGCGGTGATGGTGTCGCTT
GCGGAGTTGTGGCGTTCGGTGGGTGTGGTTCCCGATGGGGTGGTGGGTCACTCGCAGGGT
GAGATCGCTGCTGCGGTGGTGGCGGGTGGTCTGTCGCTGGAGGACGGGGCCCGGGTGGTG
GCGCTGCGATCGCAGGTCATCGGCCGCGAGCTGGCGGGGCGGGGTGGCATGGCGTCCATC
GCTTTGCCTGCGGCAGAAGTGCGTCAACGTGTAGGCGATGTACCGGAGTTGGGTGTTGCG
GCGGTTAATGGTCCGTCGTCGACGGTGGTGTCCGGGGATGCCGATGCGGTTGAGGCGTTC
GTGGTGGCTTGTGAGGCTGATGGGATTCGGGCGCGTCGTATCGCGGTGGATTACGCGTCG
CATTCGGCGCATGTGGAGGCCATCGAGCAGGAGCTGCTGACCGTCCTGGAGGACGTACGG
CCGCAGGCGGGCAGGATCCCCTTCTACTCAACGGTCGAGAACGCCTTCCTCGACACCGAG
GTCCTGGATGCCGCGTATTGGTACCGGAATCTGCGGCATCAGGTGCAGTTCGAGGCCGGT
ATTCGGGCGCTGGCCGCGGAGGGTTTCACCACGTTCGTGGAGTCCAGTGCACATCCGGTG
CTGACCGTCGGCATTCAGGAGACGCTCGACGATACGGACACCGAAGCCGTCGTCACAGGA
TCGCTTCGCCGTGACGAAGGTGGGCTGGAGCGTTTCCTGACCTCGGCCGCCGAGCTGTAC
GTCGCCGGCGTGCCGGTGGACTGGACGCCGTTCCTTGCAGATGAGGGCGTCCGCCGTGTC
GATCTGCCGACGTACGCCTTCCAACGGGAGCGCTTCTGGCTGGAAGCCCCCGTTCCCACC
GCGGGCGAGGCGACTGCTGTGGACACCCGTTTCTGGGCTGCCGTTGAGGCGGAGGACTGG
GAGGCGCTGCGGGGGGAGTTGGCGCTGGAGGGTGACGCGCCGCTGAGCGCGGTGTTGCCG
GCGTTGGCGTCCTGGCGTCGTGAGCAGCAGCGGACCTCTGCGGTGGATTCCTGGCGTTAT
CGGGTGGTGTGGAAGCCGGTGGCGGTTGAGGGTTCGGTGCCGGTGGTGGCGGGTCGGTGG
TTGGTGGTGGTGCCGGCTGGGTTTGAGAGTGACGCCGCGGTGATGGGCGTCGTGGCTGCG
TTGGAGGAGCGCGGCGTTGAGGTGCGACGGGTGGTGATTGAGGGGGCTGCGGCAGGGCGG
TCTGAGGTTGCCGATCAGTTGCGTGCGGTGGTCACCGATGACGTGAGTGGGGTGGCTGAA
GACCCGGGCACGGGTGTGGGTGTGGTGGGTGTGGTGTCGCTGTTGGCGTTGGCGGGGGGT
GGTGCGGTTTCGGCGGTGGTGTTGGTGCAGGCGTTGGGTGAGGTGGGTGTTGAGGCTCCG
CTGTGGGTGGTGACGCGGGGTGCGGTGGGTGTTGGTGGTTCGGATCGTGTGTTGAGTGCG
GTGCAGTCGCAGGTGTGGGGTGTGGGCCGGGTTGCTGCTTTGGAGTTGCCGGAGCGGTGG
GGCGGTTTGGTGGATGTGCCTGAGGGGTGGGACAGCCGGGCGGGTGCTGGTTTGTGTGCG
CTGCTGGGTGGTGCGCTGGCGGGCGAGGATCAGGTTGCGTTGCGGTCTTCGGGTGTGTGG
GTGCGTCGGGTGGCGCGCGCCGGTGGTGGCGGTTCCGCGGGGGTGTGGTGCCCGCGGGGC
ACGGTGTTGGTGACCGGTGGTACGGGCGCGTTGGGCCGTCGGGTGGCGTTGTGGGCTGCA
CGGCGCGGGGCTGAGCGGGTGGTGTTGGCCAGCCGGAGTGGTGCCGGCGCTTCGGGTTTG
GAATCGGTTGAGGCTGAGTTCGCCGCGCTGGGTGTGGAGTTGGAGGTCGCGGCGTGTGAT
GTGGCGGATCGTGGTGCGGTAGCGGAGTTGTTGGGTTCGCTTCCTGGTTTGTCGGCTGTG
GTGCATGCGGCGGGTGTGTTGGATGACGGTGTGTTGGAGGGGTTGTCGCCGGAGCGGGTG
GCGGGTGTGTTGCGGGCGAAGGCCGATGCCGCGGCCGTCCTGGACGAGTTGACCCGTGAC
CTGACCCCCGACCTCGACGCCTTCATCCTCTTCTCCTCCGTCGTCGGAACCCTGGGACGT
GCCGGTCAGGCCAACTTCGCCGCTGCCAATGCCTTCTTGGACGCGTTGGCCCAGCAGCGC
CAGGACCTCGGCCTCCCCGCCACCTCGGTGGCCTGGGGTCCGTGGAACGCGGGCGGTGCC
GCAGGCGGCGCGGTCGGTGAGGAGCTGCGCAAGCGTGGCCTTCCCGCCCTCGACGCCGAT
CTGGCGCTGACCGCGATGGCGCAGGCCGTCGGGCGTGGCGAGGCCGCCGTGATGGTGGCC
GACGTGGACTGGGAGCGCTTTGTCCCGGCCTTCACCGCGACCCGGCCCAGCCCCCTCCTC
GCCGACCTTCCGGAGGTGCGTACGTCTGCGACGGCGTCCGCGTCCGCCGGGAGCGGGGAG
GGCGACGGCACGGCTTCGTCGCTGGCGCAGCGCATGGCGGGACGGCCGGCGGCCGAGGTG
GAGCACCTGCTGCTGGACCTCGTCCGTACCCAGGCCGCGGCCGTGCTGGGGCACGCGTCG
GCGGACGCGATCGGGGAGACGCACGCTTTCAAGGACCTCGGTTTCGATTCGCTGACGGCG
GTCGAATTCCGCAATCGCCTCAAGAACGCGACCGGTCTCCGGCTGGCCCCCACCCTGGTC
TTCAACTACCCGACGCCCAAGGCACTGGCTCGCCATCTGTACGGCGAGATCGCCGGCGCC
GAGGAGTGGCAGTCGGCGAGCACGGCGGTGGCTCCGGTTGCCGCCCTGCCTGCCGTCGAG
GACGACCCGATCGTCATCGTGTCGATGGCCTGCCGCTTTCCTGGTGGGGTGAGTTCGCCG
GAGGACCTGTGGCGGCTGGTCGCCGAGGGTGGGGACGCGATTTCGGTGTTCCCGGCGGAC
CGTGGCTGGGATGTGGAGGCGCTGTACGACGCGGACCCGGACCACGCGGGCACGTCGTAC
GTGCGCGAGGGTGGCTTCCTGTACGGCGCGGCGGAGTTCGATGCGGGGTTCTTCGGGATT
TCGCCGCGTGAGGCGCTGGCGATGGATCCGCAGCAGCGGTTGCTGCTGGAGACGTCGTGG
GAGGCGTTCGAGCGGGCCGGCATCAATCCGGACGGTCTGCGCGGCAGCCGAGCCGGGGTC
TTCATGGGCGTGGTGTCGCAGGACGACTACGGGCCGCGGATGAGTGAGGCCCCGGAGGAG
TTCGAGGGCTACCTGCTCACCGGCACCGCCGCGAGCGTGGTCTCGGGTCGGTTGTCGTAC
ACGTTCGGGCTGGAGGGGCCGGCAGTGACGGTGGACACCGCGTGCTCGTCGTCGCTGGTC
GCCCTGCATCTCGCGGCGCAGTCCCTGCGGCAGGGCGAGTGCTCGGTGGCGCTCGCCGGT
GGTGCGACCGTCATGTCCACGCCGGGGACCTTTGTGGAGTTCAGTCGTCAGCGGGGGCTG
GCGGTGGATGGCCGGTGCAAGGCGTTCGCGGCGGGCGCGGACGGCACCGGGTGGGGCGAG
GGCGTCGGTGTGCTGGTGCTGGAACGGCTGTCGGACGCGCGGCGCAACGGCCATGAGGTT
CTGGCGGTGGTGCGGGGTACGGCGGTGAACCAGGACGGTGCGAGCAACGGCCTGACGGCG
CCCAACGGTCCGTCCCAGGAGCGCGTCATCCGCCAGGCGCTGGCGCAGGCCCGTCTCACT
CCGGACCAGGTGGATGTGGTGGAGGCGCACGGTACGGGGACGCGGTTGGGTGATCCGATC
GAGGCGCAGGCGTTGTTGGCGACCTACGGGCAGGGGCGGGCGGAGGGGCGGCCTCTGTGG
TTGGGGTCGTTGAAGTCGAATGTGGGGCATACGCAGGCTGCTGCGGGTGTCGGTGGTGTC
ATCAAGATGGTGATGGCGTTGCGGCAGGGTGTGTTGCCGCGGACGTTGCATGTGGACGCG
CCGTCGCCGCATGTGGACTGGTCGGCGGGTGCGGTGGAGCTGCTGACGGAGGAGCGGGCC
TGGCCTGCGGAAGCCGGCCGGGTGCGTCGTGCCGGAGTGTCGTCCTTCGGCGTGAGCGGG
ACGAATGCCCACGCGATCATCGAGCAGGCACCGGGTCACGAGGTGCCCGTCGACGAGGCA
CCGGTCGATGAGGCAGCGGCCCACAAGACATCGGCCGTTGAAGCTCCACAGCCGGATGAG
CTGGGGAAGTCGGTTGACGTGGCGGAGCCGGTTGACGTGGCGGAGCCGATTGGCGTGGGG
GAGTCGGACGAGCTGCGGGGGAATGGAGAGCAGGGGGCATCCGACCCGGCTGTCCTGCCG
TGGCTGATCGCCGGACGCAGTGCCGGGGCATTGAGGGCGCAGGCGGAGCGGCTGCGGTCA
CATGTAGCGGCGCGGCCTGAGCTGGAACCGGTGGATGTGGCTTTCACCCTCGCGACGACC
CGAGCCGCCATGGACCACCGCGCAGTGGTCCTCGCCGCGGACAGGCCGCGCCTGCTCGAT
TCCTTGACGGCGATTACCCAGGGCGAAACACCTGCCGGTGTTGTTGAGGGGTGCGTGTCG
GGTGGTTCCGGGCGTGTGGGGTTTTTGTTTTCTGGTCAGGGGTCGCAGCGGGTGGGGATG
GGGCGTGTTCTTTATGGGGCGTTTCCGGTTTTTGCTGCGGCGGTGGATGAGGTGTGTGGG
GCTTTTGACGGTGTGTTGGGTGGGTCGCTGCGTGAGGTGATGTTTGCGGAGGGGGTGGGT
GCTGAGGGGGTTTTGGAGCGTACGGAGTTTGCTCAGCCGGCGTTGTTTGCGGTTGAGGTG
GGGCTGTTTCGGTTGGTGGAGTCGTGGGGGGTGCGGGCTGATTTTGTTGCGGGGCATTCG
GTGGGGGAGCTGGCGGCTGCGTATGTGGCGGGTGTGTGGTCGTTGGCTGATGCGGTGCGG
GTGGTGGCTGCGCGGGGTCGGTTGATGCAGGCGTTGCCTGGTGGTGGGGCAATGGTGTCG
TTGGTGGCGTCGGAGGGTGAGGTGGCGCCGCTGGTTGCTGGTCGTGCGGGTGAGGTGGGT
GTGGCGGCGGTGAATGGTCCGTCGTCGGTGGTGGTGTCGGGTGCTGAGGGTGCGGTGGGG
GAGATTGCCGCGCATTTTGAGGCGTTGGGGCGGCGGGTGCGTCGTTTGCGGGTGAGTCAT
GCGTTCCATTCGCCGTTGATGGATCCGATGTTGGAGGAATTTGGTCGGGTAGTTCGGTCG
GTGGAGTTTTCTCGGCCGCGGTTGGGGATGGTGGCTGGCGAGGGGGTGTGTGATCCGGAG
TTTTGGGTGCGGCATGTGCGGGATGCGGTGCGGTTTGCGGATCAGATTTCCTGGTTGGAG
AACGCGGGTGTCTCGACGTTTGTGGAGATGGGACCGGGCGGCGTACTGACCGCCATGACA
CAGGACTGTGTCACCCGCCCCGACGCCCTCCTCGTGCCCATGCTCCAGAAGAACCTGCCG
GAGGATCACGCAATTCTCCAGGCACTGGCGGAATTGCACGTCGGCGGTGTCGCGGTTGAT
TGGGACGCATTCTTCGCCGAGCGCGGCGGCCGGCGCGTAGAGCTGCCCACCTACGCCTTC
CAGCGGCAGCACTACTGGCTCGATGGCGCTTCCGGCCGACGCGAGCGCGAGCGTGACCGG
GACGCCGGCCGCGGCGAGGGCCTGGGCCAGGGCGAGAGCCAGGGCCGGACATCCAGGTCA
CCTGCGGACTCCTGGCGTTATCGGGTGATGTGGAAGCCGGTGGCGGTTGAGGGTTCGGTG
CCGGTGGTGGCGGGTCGGTGGCTGGTGGTGGTGCCGGCTGGGTTTGAGAGTGACGCCGCG
GTGATGGGCGTCGTGGCTGCGTTGGAGGAGCGCGGCGTTGAGGTGCGACGGGTGGTGATT
GAGGGGGCTGCGGCAGATCGGTCTGAGGTTGCCGATCAGTTGCGTGCGGTGGTCACCGAT
GACGTGAGTGGGGTGGCTGAAGACCCGGGCACGGGTGTGGGTGTGGTGGGTGTGGTGTCG
CTGTTGGCGTTGGCGGGGGGTGGTGCGGTTTCGGCGGTGGTGTTGGTTCAGGCGTTGGGT
GAGGTGGGTGTTGAGGCTCCGCTGTGGATGGTGACGCGGGGTGCGGTGGGTGTGGGTGGT
TCGGATCGTGTGTTGAGTGCGGTGCAGTCGCAGGTGTGGGGTGTGGGCCGGGTTGCTGCT
TTGGAGTTGCCGGAGCGGTGGGGCGGTTTGGTGGATGTGTCTGAGGGGTGGGACAGCCGG
GCGGGTGCTGGTTTGTGCGCGGTGTTGGGTGGTGCGCTGGCGGGCGAGGATCAGGTTGCG
TTGCGGTCTTCGGGTGTGTGGGTGCGTCGGGTGGCGCGCGCCGGTGGTGGCGGTTCCGCC
GGGGTGTGGTGCCCGCGGGGCACGGTGTTGGTGACGGGTGGTACGGGCGCGTTGGGTCGT
CGGGTGGCGTTGTGGGCTGCGCGGCGGGGTGCTGAGCGGGTGGTGTTGGCGAGTCGGAGT
GGTGCCGGCGCTTCGGGTTTGGAGTCGGTTGAGGCTGAGTTTGCCGCGTTGGGTGTGGAG
TTGGAGGTCGCGGCGTGTGATGTGGCGGATCGTGGTGCGGTAGCGGAGTTGTTGGGTTCG
CTTCCTGGTTTGTCGGCTGTGGTGCATGCGGCGGGTGTGTTGGATGACGGTGTGTTGGAG
GGGTTGTCGCCGGAGCGGGTGGCGGGTGTGTTGCGGGCGAAGGCCGATGCCGCGGCCGTC
CTGGACGAGTTAACGCGTGAACTGACCCCCGACCTCGACGCCTTCATCCTCTTCTCCTCC
GCGGCCGGTGTCCTCGGCAACGAGGGCCAGGCCAACTACAGCGCCGCCAATGCCTTCTTG
GACGCGTTGGCCCAGCAGCGCCAGGACCTCGGCCTCCCCGCCACCTCGGTGGCCTGGGGA
GCCTGGGCCCACTCCGGAATGGCCATGGATGACGCCGCCTCGCAACAGTTGCACCGCACC
GGGTTCCTGGAGATGGATCCCGAGCAGGCACTGACGGAGATGGCGCAGGCCGTCGGGCGC
GGCGAGGCCGCCGTGATGGTGGCCGACGTGGACTGGGAGCGCTTCGTCCCGGCCTTCACC
GCGGCCCGGCCCAGCCCCCTCCTCGCCGACTTGCCCGAGGTACGGGAGGTATCCGCCGCC
TCTGCCGCCCTCCCGGGCGCGAGTGGCGCGGCGGAGACCCGGCACGACGCCGGCTCCCTT
GCGGAGCGACTCGCCGGACTGCCGCGCGCCGAACAGCGGGACCACCTGCTTCAGGTCGTC
CGCACGCAGGCGGCGACGGTGCTCGGCCACGCCGGGCCGCAGGCGATCGACCCCGGCCGG
GCCTTCAAGGACCTGGGCTGCGACTCGCTCGGCGCCGTACGGCTGCGTAATCGGCTGAAC
GCGGCCACCGGCCTGCGACTGCCCGCGAGCGTGGTCTACGACTACCCGACCGCAGGCGAT
CTCACCGGCTACCTCCTCGGCGTATACGCCGGCGCGGAGACGGAGACGGAGGAAGGCGCG
CCGACCGCGGACGGGATCATGGCGGGAGCGCTCGGGACCCCCGCCCCCGCCGCCGACGAG
CCGATCGCGATCGTCTCGATGAGCTGCCGCTTCCCCGGCGGCGTGGGCTCGCCGGAGGAC
CTGTGGGAGCTGCTGGCCGGCGGCGGCGACGGACTCTCCGCCTTCCCCGCCGAACGCGGC
TGGGACCTCGACGCCCTCTACGACCCGGACCCGGACCGTTCCGGCACCTCCTACGTCAGG
GAGGGCGGATTCCTCGACGACGTGGACCGCTTCGACGCCGCCTTCTTCGGCATCAACCCG
CGTGAGGCGCTGGCGATGGACCCGCAGCAGCGGTTGCTGTTGGAGACGTCGTGGGAGGCG
TTCGAGCGGGCCGGCATCGACCCTCGGTCGCTCCGCGGCTCCAAGACGGGTGTCTTCGTC
GGCAGCAACGGACAGGACTACGCCACCCTGCTGCGGCAGGATCCGGGGGCCGTGGAGGGA
TACCTCGGCACGGGCATCGCGGCGAGTGTGGCCTCGGGCCGGGTGTCGTACACCTTCGGG
CTGGAGGGTCCGGCGGTGACGGTGGACACCGCGTGCTCCTCGTCGCTGGTCGCCCTGCAT
CTCGCGGCACAGTCCCTGCGGCAGGGCGAGTGCACCTTGGCCCTGGCGGGCGGCGTCACG
GTGATGACGACCCCCGAAGTCTTCGTCGAGTTCAGTCGTCAGCGGGGGCTGGCGGCGGAC
GGCCGGTGCAAGGCGTTCGCGGCCGGTGCGGACGGCACCGGGTGGGGCGAGGGCGTCGGT
GTGCTGGTGCTGGAGCGTTTGTCGGACGCCCGCCGTAACGGTCACGAGGTCCTGGCGGTG
GTGCGGGGTACGGCGGTGAACCAGGACGGTGCGAGCAACGGCCTGACGGCCCCGAACGGT
CCTTCGCAGCAGCGGGTGATCCGCCAGGCGCTGGCGCAGGCCCGTCTCACCCCGGACCAG
GTGGATGCGGTGGAGGCGCACGGCACCGGTACGACGCTGGGCGATCCGATCGAGGCGCAG
GCGTTGCTGGCGACGTACGGGCAGGGCCGGGCCGAGGACCGGCCGCTGTGGCTCGGTTCG
GTGAAGTCGAACATCGGCCACACCCAGGCGGCAGCCGGCGCGGCCGGTGTCATCAAGATG
GTGATGGCGTTGCGGCAGGGTGTGTTGCCGCGGACGTTGCATGTGGACGCGCCGTCGCCG
CATGTGGACTGGTCGGCAGGTGCGGTGGAGCTGCTGACGGAGGAGCGGGCCTGGCCTGCG
GAAGCCGGCCGGGTGCGTCGTGCCGGCGTGTCGTCCTTCGGCGTGAGCGGGACGAATGCC
CACGCGATCATCGAGCAGGCACCGGCCGCGGAGGCCGAGGAGACGCCGTCCGTTGACGCC
CCTCACTCCGATGAGCTCGCGGCTTCCGCGTCGGTTGTGGTGCCGTGGGTGGTCTCGGGG
CGTGGTGAGGGCGCGTTGCGGGCGCAGACGGAGCGGTTGCGGTCGTTCGTCGAGGCGAGG
CCGGAGCTGAATCCGACCGACGTGGGGTTCTCGCTCGCGCTGCGGGCCCCGATGGAGAAC
CGTGCCGTGGTCCTCGCCGCAGGCCGGTCGGGCCTGCTGGAGGGGCTGGGTGCGGTGTCT
CGCGGTGAGGTGCCGGCGGCTGGTGTGGTGCAGGGGGCAGGCGCGGTCCGCGAGGCGGGC
CGGACGGTCTTGGTTTTCCCTGGTCAGGGTTCTCAGTGGGTCGGTATGGGCGCGGAGTTG
ATCGCGTCGTCGCCGGTGTTCGCTGAGTGGATGCGGCGGTGCGCGGAGGCGCTGGCTCCG
TTCGTTGACTGGGATCTGCTGGAGGTTGTGACCGAAGGCCGTGGGTTGGACCGGGTGGAT
GTGGTGCAGCCGGTGACGTGGGCGGTGATGGTGTCGCTTGCGGAGTTGTGGCGGTCGGTG
GGCGTTGTGCCAGATGCGGTTTTGGGCCACTCGCAAGGCGAGATCGCTGCTGCGGTGGTG
GCGGGCGCTCTGTCGTTGGAGGACGGGGCCCGGGTGGTGGCGCTGCGGTCGCAGGTCATC
GGCCGCGAGCTGGCCGGACGCGGTGGCATGGCATCCCTTGCGCTTCCCGAGGCCGAGGTG
CGGGACCGACTGAAGACGCAGACGGGCCTTGGCATAGCTGCCGTCAACGGGCCGCGTTCC
ACGGTGATTTCGGGTGATGCGGAGGCGGTCGAGTCCTTTGTTTCCTCTTGCGAAACGGAG
GGCATCCGGGCGCGTCGTATTGCGGTGGATTACGCGTCGCATTCGGCGCATGTGGAGGCC
ATCGAGCAGGAGCTGCTGACCGTTTTGGAGGGCGTACGGCCGCAGGCGGGCAGTGTCCCC
TTCTACTCGACGGTGGAAGACGCCTTCCTGGACACCGAGGTCTTGGATGCCGCGTACTGG
TACCGGAATCTGCGCCGCCAGGTGCAGTTCGAAGCGGGTATTCGGGCGCTGGCGGCGGAC
GGTTTCACCACCTTCGTGGAGTCCAGTGCGCATCCGGTGCTGACCGTCGGCATTCAGGAG
ACGCTTGACGATACGGACGCCGAGGCCGATACCGAGGCCGTCGTAGCAGGCTCCCTCCGC
CGTGACGAGGGGGGTCTGGAGCGTTTCCTGACCTCGGCCGCCGAGCTGTATGTCGCCGGT
GTGCCGGTGGACTGGTCGTCGTTCCTTGGGGGTGAGGGCGCCCGGCGCGTCGAGCTGCCC
ACCTATGCCTTCCAAGGCCGTCGTTACTGGCCGCGTACCGCTCCCGCGAAGTCGGCTGAT
GCCCTGTCCTTCGGCCTCGGGTCGACGCGTCATCCGTTGTTGGGGGCGGCGGTTGAGGTT
GCCGGGTCGGATGAGGTGTTGTTCACCGGGCGGTTGTCGCTGGAGTCGCATCCGTGGCTG
GCGGATCATGCGGTGGCCGGGACGGTGTTGTTGCCGGGTACGGCGTTTGTGGAGCTTGCG
GTGCGTGCCGGCGACGAGGTCGGTTGCGGGCAGGTCGAGGAGCTGGCGTTGGAGGCTCCA
TTGATCGTGCCGGAGCGTGGCGGTATCGCCCTCCAACTCGGACTGGGTGCCGCCGACGAC
TCCGGACGCCGCACGCTGACCCTGCACTCTCGGGCTGCGGAGGACGGCGACGGCCCCTGG
ACGCGGCACGCCACCGGCACCATGGCTCCCGCAGGGGCCCCGGCCAGTGGCGAGGCCCCG
GACCCGGCGGACTCCGCGAGCCCCGTGGCCGCCACCGAGACCGCCTTGACCGACCAGACC
GCCCTGACCGACAAGACCGACCTGACCGTCTGGCCTCCCGCTGAAGCCGTCCCCGTACCC
GTCGACGACGCGTACGAGCGGCTGGCCGCGCTCGGTGTCGACTACGGTCCGGCCTTCCAC
GGGCTGCGGGCGGCCTGGCGGCGCGGCGACGAACTGTTCGCCGAGGTCCAGCTGCCCGAG
GCGGTGGCGGCGGACGCGGCGGCCTTTGGCCTGCACCCCGCCCTGCTGGACGCCGCCCTC
CAGCCGCTCGGCCTCGGAACTCTCTTCCCGGAGCCCGAACCCGGGTACAGCAGGCGGCCG
TTCGTGTGGAGTGGCGTACGGCTCCACGCCACGGGCGCCGATGCGCTGCGCGTACGCGTG
ATCCGGACGGGGGAGGAGGCCGTGTCCGTCGTCGTTGCCGACGCCAAGGGGGAGACGGTT
GCGACGGTCGACACCCTGACATTCCGTCAAGTGAGCGATGAGGGGCCGTCGCCCGCAACA
GGGACGCACCACGACTCGCTCTTCCGGTACGAGTGGGTCCCGGTCGCCGTACCCCGCGCC
GAGTTCCGCCCCGCGCCGGCCGGCGCGCGCTGGGTCGTCCTGAGCACAGGGCCGGACGGT
TATGCGGATCCGACGGCACTCGGTGACGTGCTCGGTGGTGGCGACGACGTACCTGAGCTG
GTCTTCGCCCCCATGACCAGGGCCAGGGCCGGGATCGAGGAGGTGGCGGGTCTCCAGGAG
ACGGATGGTCTCCAGGAGGCGGACGGGCTTCGAGAGACGGACGGGCTCCAGGGGACGGAC
GAGAACGTCGCCGAGGCGGTCCGTGCCGCTGCGCACCGTGCGCTGGAACTGGTGCAGGCG
TGGCTGGCCGACGAGCGGTCCGAGGCGTCCCGGCTGGTGATCGTGGCCCGGCAGGATCTG
GTCGGAGCCCCGGTATGGGGGCTCGTACGGTCGGCGCAGGTGGAGAACCCTGGGCGGTTC
GTCCTGCTGGAGACGGACGGTGCACACGCCGAAGAGCGGCCGGCGGCAGGGGCCGCGGCT
CCGTGGGAGGCGATGGCAGCGGCGGTGGCCACCGGTGAACCGCAGCTCAGGCTCTGCGCC
GGTGAGGTCACCGCGGCCCGTCTGGTCCGCGCGGCAGCACCACCTGCCGGCACCCGGGCC
GATGTCATCCCGGACACGGCCTCCGATGCCACTGTCGACGCCACAGCCACAACGCACGTC
ACCGTGGACACCAGTCCGGACGCCGCCCCCGACGCCGCCTCGGACGTCTCCCCGGACGGC
ACCTCCGCAGCCGTAGGCGCTGCGTTCGACCCGAACGGAACGGTCCTGGTCACCGGCGCG
TCCGGTGGTCTCGCCCGGCTGCTCGCCCGTCATCTGGTGGTCGAACGCGGTGTCCGGCAC
CTGCTGCTGACCAGCCGGCGCGGTCCGGCCGCGGACGGTATGCCGGAGCTGGCGGCCGAG
CTGACCGAACTGGCGAGGGCGGCCGAGAGGGCACGCGCGGCGGGGCCGGCCGGGGCCGCC
CTCTCTGATCCCTCGGTCGAGGTCGTGGCCTGCGATGTCGCCGATCGGGCGCAGCTCGCG
AAGGTGCTGGCCGCCGTCCCCGCGGACCGGCCGCTCACCGCCGTCGTACACACCGCGGCC
GAGCTCGACGACGGGGTCGTCCACGCGTTGAACCCCGAGCGGATCGACCGCGTGCTGCGG
CCGAAGGTTGACGGCGCGCTGAATCTGCACGCCCTCACCGCGCACCTGGACCTGTCCGCC
TTCGTGCTCTTCTCCTCCCTCTCGGGGACCCTCGGCGGCGCCGGGCTGGCCAACTACTCG
GCGGCCAATGCCTTCTTGGACGCGCTGGCCCGGCACCGCCGCGCACACGGCTTGCCCGCC
GTTTCGCTGGCATGGGGCCTGTGGGAGCAGCGCAGTGGCATGGCCGGCCGGCTCAGCGAC
GTCGACCTGGCCCGGATGTCCCGCGTCGGCGCCGCACCCATGCCGGCCGAGGAAGGGCTG
GCGCTCTTCGACGCCGCCACGGCGTACGGAGCGGCGTACGGGGAACCGGTCGTCGTGCCC
GCCCGCCTGGACACCGCCGAGCTGCGGTCACAGGCCGCGGCCGGAGTGCTGCCCCCGCTG
TTCCGGAGCGTCGTCCGTACGGTGCCGGTGCGCCGGTCCCTCGCGGCGTCCGGCGCGCAG
GGGACCGAAGGGGCCGACGGGGCTGCCGGGGCCGAGGAACCGGGCAGCGCCCTGGCCGCA
CGGCTGGCAGGTGTGGCCCGGTCGGAGCAGGACCGGCTGCTGCTCGAACTGGTACGGGAG
CAGGCCGCGTCGGTCCTGGGGCACCCCTCCACCGACGAGGTCCAGGGGAACCGCGCCTTC
AAGGACCTCGGCCTCGACTCGCTGACCGCCGTCGAGCTACGCAACCGGCTCAAGCGCGCG
ACCGGCCTGCGACTCGCCCCGACCCTGGTCTTCGACTATCCGACCCCCGTCGCGCTCGCC
CAGCGACTGCGCACCGAGCTGGTACCGGACGGGCCGGAAAACGAACCCGCCGTCTTGGCG
GACCTGGAGCGGCTCGAAGCGGCGCTGTCCGACGTCGCTTCCGACGACTCCGTACGCGAC
AAGGTCGCGGCGCGGCTGCAAGCCCTGCTCTGGCGCTGGGAGGACAGCCGCAGCGCCGGG
AGCGAGCAGCAAAGCACGGAAGAAAAGCAGGAGTTCGACCCCAGCTCGGACGAGGAGATG
TTCGCGCTGATCGACGAAGAGTTCGGAGACCTCTGA
[0] KSQ29..394
[0] AT559..870
[0] malonyl-CoA751..755
[0] ACP954..1032
[1] KS1069..1445
[1] AT1610..1925
[1] methylmalonyl-CoA1798..1802
[1] KR2240..2418
[1] ACP2524..2594
[2] KS2622..2999
[2] AT3208..3519
[2] malonyl-CoA3400..3404
[2] KR3807..3985
[2] ACP4096..4166
[3] KS4199..4576
[3] AT4743..5062
[3] methylmalonyl-CoA4931..4935
[3] DH5111..5302
[3] KR5693..5891
[3] ACP6014..6084
[0] KSQ85..1182
[0] AT1675..2610
[0] malonyl-CoA2251..2265
[0] ACP2860..3096
[1] KS3205..4335
[1] AT4828..5775
[1] methylmalonyl-CoA5392..5406
[1] KR6718..7254
[1] ACP7570..7782
[2] KS7864..8997
[2] AT9622..10557
[2] malonyl-CoA10198..10212
[2] KR11419..11955
[2] ACP12286..12498
[3] KS12595..13728
[3] AT14227..15186
[3] methylmalonyl-CoA14791..14805
[3] DH15331..15906
[3] KR17077..17673
[3] ACP18040..18252

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [556-680]  G3DSA:3.40.366.10 [750-849]  G3DSA:3.40.366.10 [1604-1730]  G3DSA:3.40.366.10 [1798-1915]  G3DSA:3.40.366.10 [3202-3332]  G3DSA:3.40.366.10 [3400-3508]  G3DSA:3.40.366.10 [4738-4863]  G3DSA:3.40.366.10 [4931-5052]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR006162 Phosphopantetheine attachment site (PTM)
 [6042-6057]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [954-1032]  PS50075 [2524-2594]  PS50075 [4096-4166]  PS50075 [6014-6084]  PS50075
PS50075   ACP_DOMAIN
 [955-1085]  4.49999046578037e-23 SSF47336 [2524-2638]  1.50000306971104e-26 SSF47336 [4089-4216]  1.10000150671642e-25 SSF47336 [6006-6101]  6.39998633403535e-22 SSF47336
SSF47336   ACP_like
 [962-1035]  3.49999999999995e-86 G3DSA:1.10.1200.10 [2524-2598]  3.49999999999995e-86 G3DSA:1.10.1200.10 [4093-4166]  3.49999999999995e-86 G3DSA:1.10.1200.10 [6014-6087]  3.49999999999995e-86 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [969-1031]  3.6e-08 PF00550 [2527-2593]  6.40000000000001e-13 PF00550 [4099-4165]  9.60000000000001e-11 PF00550 [6017-6083]  8.9e-13 PF00550
PF00550   PP-binding
IPR013968 Polyketide synthase, KR (Domain)
 [2240-2417]  4.39999999999997e-53 PF08659 [3807-3984]  9.9e-55 PF08659 [5693-5890]  6.49999999999992e-55 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [29-268]  1.29999999999998e-84 PF00109 [1069-1319]  8.39999999999977e-97 PF00109 [2622-2873]  4.69999999999992e-98 PF00109 [4199-4450]  3.60000000000002e-102 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [276-394]  2.1e-41 PF02801 [1327-1445]  8.00000000000001e-48 PF02801 [2881-2999]  1.09999999999999e-47 PF02801 [4458-4576]  2.70000000000002e-49 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [559-870]  7.59999999999998e-58 PF00698 [1610-1925]  2.70000000000002e-103 PF00698 [3208-3519]  1.29999999999998e-60 PF00698 [4743-5062]  1.5e-103 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [556-864]  2.2999842048857e-66 SSF52151 [1608-1907]  1.90000694315261e-63 SSF52151 [3205-3513]  1.19999063421924e-66 SSF52151 [4741-5029]  2.80000504261099e-64 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [685-750]  1.09999909120787e-16 SSF55048 [1733-1797]  7.99999145876753e-18 SSF55048 [3334-3399]  3.60000433965927e-17 SSF55048 [4866-4930]  2.39999798157265e-17 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [30-280]  G3DSA:3.40.47.10 [281-448]  G3DSA:3.40.47.10 [1069-1330]  G3DSA:3.40.47.10 [1331-1498]  G3DSA:3.40.47.10 [2622-2884]  G3DSA:3.40.47.10 [2885-3051]  G3DSA:3.40.47.10 [4199-4461]  G3DSA:3.40.47.10 [4462-4629]  G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [20-448]  5.50001754266469e-93 SSF53901 [1061-1443]  5.79999653854781e-102 SSF53901 [2614-2997]  4.60000044330866e-104 SSF53901 [4199-4574]  7.90003079443025e-109 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [2240-2424]  3.49999999999995e-108 G3DSA:3.40.50.720 [3807-3991]  3.49999999999995e-108 G3DSA:3.40.50.720 [5693-5908]  7.30000000000007e-93 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [1232-1248]  PS00606 [2786-2802]  PS00606 [4363-4379]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020683 Ankyrin repeat-containing domain (Domain)
 [159-224]  PS50297
PS50297   ANK_REP_REGION
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [560-850]  3.39999972437719e-104 SM00827 [1612-1906]  1.50000965748778e-119 SM00827 [3209-3499]  3.699978135861e-106 SM00827 [4745-5043]  1.19999063421924e-117 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [963-1035]  1.29999924468179e-27 SM00823 [2525-2597]  4.19999771339582e-34 SM00823 [4097-4169]  3.89999861795218e-31 SM00823 [6015-6087]  7.60000011115808e-35 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [5111-5302]  1.69998802370953e-82 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [30-448]  SM00825 [1071-1498]  SM00825 [2624-3052]  SM00825 [4202-4629]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [2240-2418]  4.60000044330862e-53 SM00822 [3807-3985]  4.50001022902825e-57 SM00822 [5693-5891]  1.99999636034521e-54 SM00822
SM00822   PKS_KR
SignalP No significant hit
TMHMM No significant hit