close all open/close all

CDS information : Strply_00320


close this sectionLocation

Organism
StrainNRRL 2433 (=NBRC 13058)
Entry nameStreptolydigin
Contig
Start / Stop / Direction75,897 / 76,637 / + [in whole cluster]
75,897 / 76,637 / + [in contig]
Location75897..76637 [in whole cluster]
75897..76637 [in contig]
TypeCDS
Length741 bp (246 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)putative integral membrane protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in streptolydigin biosynthesis.
Note (GenBank)
  • ORF3
Reference
ACC
PmId
[19875077] Deciphering biosynthesis of the RNA polymerase inhibitor streptolydigin and generation of glycosylated derivatives. (Chem Biol. , 2009)

close this sectionSequence

selected fasta
>hypothetical protein [putative integral membrane protein]
MHGPPLVSWLLVLLCTGAGVYCLALAHRAPSGQRAETRGEGLMALGMAAMALPASAVAPP
AWWPWLFTAAFGAAGLWALVRRHLHHAVGAGAMVYMALVMVGPSGAMDHMRHMGGTGPMD
QVSQLDQAHQVGQLGQAGALGSVAHSAPGGLPLLTGLLLAYYTVYVIGAGVRLVPGAASA
VAEPALPEGPVTGGPVTGGPVRHGPVTGGSATRGGPVPAAGAWPAGVLRACRVAMGIGML
AMLLAV
selected fasta
>hypothetical protein [putative integral membrane protein]
GTGCACGGACCGCCGTTGGTCAGCTGGCTGCTGGTGCTGCTGTGTACGGGCGCCGGTGTG
TACTGCCTGGCGCTGGCGCACAGGGCGCCGTCCGGACAGCGGGCGGAGACCCGCGGCGAG
GGGCTGATGGCGCTCGGGATGGCAGCGATGGCGCTGCCGGCGTCCGCGGTGGCCCCGCCG
GCGTGGTGGCCGTGGCTGTTCACCGCGGCCTTCGGGGCCGCGGGCCTGTGGGCACTGGTG
CGACGGCATCTGCATCACGCGGTGGGGGCGGGGGCGATGGTGTACATGGCGCTCGTGATG
GTCGGACCGTCGGGGGCCATGGATCACATGCGTCACATGGGCGGGACCGGCCCCATGGAT
CAGGTGAGCCAGCTCGACCAGGCGCATCAGGTGGGTCAGTTGGGTCAGGCGGGGGCGCTG
GGTTCCGTGGCGCACTCCGCCCCGGGCGGGTTGCCGCTGCTGACGGGGCTGCTGCTCGCC
TATTACACGGTGTACGTCATCGGCGCGGGGGTCCGGCTGGTGCCGGGTGCGGCCTCCGCG
GTGGCCGAGCCGGCGCTGCCCGAGGGGCCGGTGACGGGCGGGCCGGTGACGGGCGGGCCG
GTGAGGCACGGGCCGGTGACGGGCGGATCCGCGACGCGCGGCGGGCCGGTACCGGCCGCG
GGTGCCTGGCCGGCCGGCGTACTGCGCGCGTGCCGGGTGGCGATGGGCATCGGCATGCTG
GCGATGCTGCTGGCCGTGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP
 [1-26]  0.718 Signal
Bacteria, Gram-negative   
 [1-26]  0.494 Signal
Bacteria, Gram-positive   
 [1-22]  0.991 Signal
Eukaryota   
TMHMM
 [5-27]  Transmembrane (o-i) [40-57]  Transmembrane (i-o) [61-80]  Transmembrane (o-i) [87-106]  Transmembrane (i-o) [149-171]  Transmembrane (o-i)
Transmembrane 5