close all open/close all

CDS information : Strply_00330


close this sectionLocation

Organism
StrainNRRL 2433 (=NBRC 13058)
Entry nameStreptolydigin
Contig
Start / Stop / Direction76,841 / 77,776 / + [in whole cluster]
76,841 / 77,776 / + [in contig]
Location76841..77776 [in whole cluster]
76841..77776 [in contig]
TypeCDS
Length936 bp (311 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)putative integral membrane protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in streptolydigin biosynthesis.
Note (GenBank)
  • ORF4
Reference
ACC
PmId
[19875077] Deciphering biosynthesis of the RNA polymerase inhibitor streptolydigin and generation of glycosylated derivatives. (Chem Biol. , 2009)

close this sectionSequence

selected fasta
>hypothetical protein [putative integral membrane protein]
MMVPIALMILGVLAAAMAPRLMARSDWPDREPVLALWVWQCVVAGVLLCCVLAMSLSAAA
AWEAVRSPVFGFAPRVVVEAYALNAYGPWAGVLALLLAGGGAWTAVALTREVRAARARRR
QCRADLLRRAPLMPGEEPAGERLVVLESERPEAWWLQRASAQLVITTSALRRLKDRQLDA
LIAHEQGHVRARHDLLLYCSSALASGHPQIRVFAAFRDQVHRLVELAADDAASRRFGRLA
IALALIELNEDRGVFGPCPPQLAEVPARVDRLLAPAPRFTAGRRLRMTAIAALVPAVPLL
VTFIPGLTALT
selected fasta
>hypothetical protein [putative integral membrane protein]
ATGATGGTCCCGATCGCGCTGATGATTCTCGGCGTGCTGGCCGCGGCGATGGCGCCACGG
CTGATGGCCCGTTCGGACTGGCCCGACCGCGAGCCGGTGCTCGCCCTGTGGGTGTGGCAG
TGCGTGGTCGCCGGTGTCCTGCTGTGCTGCGTCCTCGCGATGTCGCTGAGCGCGGCCGCC
GCCTGGGAGGCCGTCCGCAGCCCGGTGTTCGGCTTCGCGCCCCGGGTGGTCGTCGAGGCG
TACGCGCTCAACGCGTACGGGCCGTGGGCCGGAGTGCTGGCCCTCCTCCTCGCGGGCGGT
GGCGCCTGGACGGCCGTCGCGCTGACCCGCGAGGTACGCGCGGCCCGGGCGCGCCGCCGG
CAGTGCCGGGCCGATCTGCTGCGCCGGGCCCCGCTTATGCCGGGCGAGGAGCCCGCCGGG
GAGCGGCTGGTGGTGCTGGAGAGTGAGCGCCCGGAGGCATGGTGGCTGCAGCGTGCCTCG
GCCCAACTGGTCATCACCACCTCGGCGTTGCGACGGCTGAAGGATCGTCAGCTCGATGCG
TTGATCGCCCATGAGCAGGGCCACGTGCGGGCCCGGCACGATCTCCTGCTCTACTGCTCC
TCGGCGCTGGCCTCCGGCCATCCGCAGATCCGCGTCTTCGCCGCCTTCCGCGACCAGGTG
CACCGGCTGGTCGAACTGGCCGCCGACGACGCGGCGTCGCGCCGTTTCGGCCGGCTGGCG
ATAGCCCTGGCGCTGATCGAACTCAACGAGGACCGCGGGGTGTTCGGCCCCTGCCCGCCG
CAACTCGCCGAGGTCCCCGCTCGCGTGGACCGCTTGCTGGCCCCCGCGCCGCGCTTCACC
GCCGGCCGCCGGCTGCGGATGACCGCGATCGCGGCGCTGGTCCCCGCGGTACCGCTGCTG
GTGACGTTCATCCCTGGCCTGACCGCGCTGACGTAA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001915 Peptidase M48 (Family)
 [139-205]  2.5e-08 PF01435
PF01435   Peptidase_M48
SignalP
 [1-61]  0.779 Signal
Eukaryota   
 [1-23]  0.999 Signal
Bacteria, Gram-negative   
 [1-23]  0.992 Signal
Bacteria, Gram-positive   
TMHMM
 [4-23]  Transmembrane (o-i) [36-58]  Transmembrane (i-o) [87-109]  Transmembrane (o-i) [288-310]  Transmembrane (i-o)
Transmembrane 4