close all open/close all

CDS information : Strply_00340


close this sectionLocation

Organism
StrainNRRL 2433 (=NBRC 13058)
Entry nameStreptolydigin
Contig
Start / Stop / Direction77,818 / 78,480 / + [in whole cluster]
77,818 / 78,480 / + [in contig]
Location77818..78480 [in whole cluster]
77818..78480 [in contig]
TypeCDS
Length663 bp (220 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)putative integral membrane protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in streptolydigin biosynthesis.
Note (GenBank)
  • ORF5
Reference
ACC
PmId
[19875077] Deciphering biosynthesis of the RNA polymerase inhibitor streptolydigin and generation of glycosylated derivatives. (Chem Biol. , 2009)

close this sectionSequence

selected fasta
>hypothetical protein [putative integral membrane protein]
MSHGVRRALPCAALFLMLLALVVLRWGPLLSLDAAVSGALHRTAVASPGWTRVSRVLSDW
VWDPWAMRALLAVAIGLLVRRGAPLLAVWVGATALAGTALQQLVKALVGRARPVWPDPVD
SAHYAAFPSGHAMSALVAGVLLLWLLRLYGARPGWRWTARVLVVLSVVGVGCTRVFLGVH
WPSDVLGGWLLGGAVVAGSAGAYAVCARRWAPRTVPAHGA
selected fasta
>hypothetical protein [putative integral membrane protein]
ATGTCGCACGGCGTCCGCCGCGCCCTTCCCTGCGCGGCCCTGTTCCTGATGCTGCTCGCC
CTGGTCGTCCTGCGCTGGGGCCCGTTGCTGTCGCTGGACGCGGCGGTCAGCGGCGCGCTG
CACCGGACGGCCGTCGCCTCGCCGGGCTGGACCCGGGTGAGCCGGGTGCTCAGCGACTGG
GTGTGGGATCCCTGGGCGATGCGCGCGCTGCTCGCGGTCGCGATCGGGCTGCTCGTACGG
CGTGGTGCGCCGCTGCTCGCGGTCTGGGTGGGGGCCACCGCACTGGCCGGTACGGCGCTC
CAGCAGCTGGTGAAGGCGCTGGTCGGCCGGGCGCGCCCGGTCTGGCCGGATCCGGTGGAC
TCGGCGCACTACGCGGCGTTCCCGTCGGGGCATGCGATGTCGGCGCTGGTGGCGGGCGTC
CTGCTGCTGTGGCTGCTGCGGCTGTACGGGGCACGGCCCGGGTGGCGGTGGACGGCGCGG
GTGCTGGTCGTGCTCTCCGTCGTCGGCGTCGGCTGCACCCGGGTGTTTCTGGGGGTGCAC
TGGCCGTCGGACGTCCTCGGCGGGTGGCTGCTGGGCGGTGCCGTGGTGGCCGGGTCGGCC
GGGGCATACGCCGTCTGCGCGCGCCGGTGGGCGCCGCGGACCGTTCCGGCGCACGGCGCA
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000326 Phosphatidic acid phosphatase type 2/haloperoxidase (Family)
 [83-200]  4.79999776836274e-14 SM00014
SM00014   acidPPc
 [12-213]  3.1999989904635e-27 SSF48317
SSF48317   AcPase_VanPerase
 [88-199]  2.3e-20 PF01569
PF01569   PAP2
IPR016118 Phosphatidic acid phosphatase/chloroperoxidase, N-terminal (Domain)
 [16-213]  3.3e-31 G3DSA:1.20.144.10
G3DSA:1.20.144.10   P_Acid_Pase/Cl_peroxidase_N
SignalP
 [1-34]  0.872 Signal
Bacteria, Gram-negative   
 [1-34]  0.998 Signal
Bacteria, Gram-positive   
 [1-31]  0.989 Signal
Eukaryota   
TMHMM
 [7-29]  Transmembrane (i-o) [61-78]  Transmembrane (o-i) [85-104]  Transmembrane (i-o) [124-146]  Transmembrane (o-i) [159-181]  Transmembrane (i-o) [185-207]  Transmembrane (o-i)
Transmembrane 6