close all open/close all

CDS information : Strply_00350


close this sectionLocation

Organism
StrainNRRL 2433 (=NBRC 13058)
Entry nameStreptolydigin
Contig
Start / Stop / Direction78,477 / 79,205 / + [in whole cluster]
78,477 / 79,205 / + [in contig]
Location78477..79205 [in whole cluster]
78477..79205 [in contig]
TypeCDS
Length729 bp (242 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative hydrolase
Product (GenBank)putative hydrolase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in streptolydigin biosynthesis.
Note (GenBank)
  • ORF6
Reference
ACC
PmId
[19875077] Deciphering biosynthesis of the RNA polymerase inhibitor streptolydigin and generation of glycosylated derivatives. (Chem Biol. , 2009)
Related Reference
ACC
Q51645
PmId
[1376111] Molecular biology of the 2-haloacid halidohydrolase IVa from Pseudomonas cepacia MBA4. (Biochem J. , 1992)
Family/Domain
FD
IPR005833

close this sectionSequence

selected fasta
>putative hydrolase [putative hydrolase]
MMDGMTTTSRMTTIKGVLFDFSGTLLRIESPESWLRAALTATGTEMDEAEIAVRAAELDR
AGALPGGTSPARLPAELAALWEIRDRDARHHRAVYTGLARQVALPQPELYDVLYDRHMTA
EAWHPYPDAAEVLAELHRRGLRIGVLSNIGWDLRPVLRAHGLDRHLDSCVLSYEHGIQKP
DPQLFALACRELGLPPSAVLMVGDDRRADGGATALGCAFLPVDHLPVDLRPDGLRPVLDV
VG
selected fasta
>putative hydrolase [putative hydrolase]
ATGATGGACGGTATGACGACGACCAGCCGTATGACCACGATCAAGGGTGTGCTCTTCGAC
TTCTCCGGGACCCTGCTGCGCATCGAGTCCCCGGAGTCCTGGCTGCGTGCGGCGCTGACC
GCGACCGGTACGGAGATGGACGAGGCCGAGATCGCCGTGCGGGCGGCCGAGCTGGACCGG
GCGGGTGCCCTCCCCGGCGGTACCTCCCCCGCACGGCTGCCCGCCGAGCTGGCCGCGCTG
TGGGAGATCCGCGACCGCGACGCCCGTCACCACCGCGCGGTGTACACCGGCCTGGCCCGC
CAAGTCGCCCTTCCGCAACCGGAGTTGTACGACGTCCTCTATGACCGCCACATGACGGCG
GAGGCATGGCACCCGTACCCGGACGCCGCCGAGGTGCTGGCGGAACTGCACCGGCGCGGC
CTCCGGATCGGCGTGCTCAGCAATATCGGCTGGGATCTGCGGCCGGTACTGCGCGCCCAC
GGCCTCGACCGCCATCTGGACAGCTGTGTGCTCTCCTACGAACACGGGATCCAGAAGCCG
GACCCGCAGCTCTTCGCCCTCGCCTGCCGGGAGTTGGGGCTCCCGCCGTCCGCCGTGCTG
ATGGTCGGCGACGACCGCCGGGCGGATGGCGGGGCCACCGCGCTGGGGTGCGCCTTCCTG
CCGGTCGACCACCTTCCGGTGGACCTCCGCCCGGACGGGCTGCGGCCGGTGCTGGACGTC
GTGGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005833 Haloacid dehalogenase/epoxide hydrolase (Family)
 [14-25]  9.59999914716171e-12 PR00413 [136-149]  9.59999914716171e-12 PR00413 [166-182]  9.59999914716171e-12 PR00413 [184-204]  9.59999914716171e-12 PR00413
PR00413   HADHALOGNASE
IPR006402 HAD-superfamily hydrolase, subfamily IA, variant 3 (Family)
 [112-207]  1.4e-07 TIGR01509
TIGR01509   HAD-SF-IA-v3
IPR006439 HAD-superfamily hydrolase, subfamily IA, variant 1 (Family)
 [126-209]  4.20000000000001e-07 TIGR01549
TIGR01549   HAD-SF-IA-v1
IPR023214 HAD-like domain (Domain)
 [114-221]  4.5e-28 G3DSA:3.40.50.1000
G3DSA:3.40.50.1000   HAD-like_dom
 [11-241]  1.99999636034521e-35 SSF56784
SSF56784   HAD-like_dom
SignalP No significant hit
TMHMM No significant hit