close all open/close all

CDS information : Strply_00370


close this sectionLocation

Organism
StrainNRRL 2433 (=NBRC 13058)
Entry nameStreptolydigin
Contig
Start / Stop / Direction79,840 / 80,457 / + [in whole cluster]
79,840 / 80,457 / + [in contig]
Location79840..80457 [in whole cluster]
79840..80457 [in contig]
TypeCDS
Length618 bp (205 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative TetR family transcriptional regulator
Product (GenBank)putative TetR-family transcriptional regulator
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in streptolydigin biosynthesis.
Note (GenBank)
  • ORF8
Reference
ACC
PmId
[19875077] Deciphering biosynthesis of the RNA polymerase inhibitor streptolydigin and generation of glycosylated derivatives. (Chem Biol. , 2009)
Family/Domain
FD
IPR001647

close this sectionSequence

selected fasta
>putative TetR family transcriptional regulator [putative TetR-family transcriptional regulator]
MVRVGLTTERLVRAGAELADEVGFDQVTVSALARRFEVKVASLYSHVKNSQDLKTKIALL
ALEELADRGAAALAGRAGKDALTALANVYRDYAREHPGRYAAAQLRLTPAEAAASAGGRH
AQMTRAILRGYELSEPDQTHAVRLLGSVFHGYVSLELGGGFSHSAPDSQETWERILDGLD
ALLRNWPAQAAPSPGPADSGHRTTR
selected fasta
>putative TetR family transcriptional regulator [putative TetR-family transcriptional regulator]
ATGGTGCGCGTGGGGCTGACCACGGAGCGTCTGGTCCGGGCGGGAGCGGAACTGGCCGAT
GAGGTCGGCTTCGACCAGGTGACCGTCTCGGCGCTCGCCAGGCGGTTCGAGGTCAAGGTC
GCGAGTCTGTACTCGCACGTGAAGAACTCCCAGGACCTCAAGACCAAGATCGCGCTGCTG
GCCCTGGAGGAGCTCGCCGACCGGGGCGCCGCCGCGCTGGCCGGCCGGGCCGGCAAGGAC
GCCCTGACCGCCTTGGCGAACGTCTACCGCGACTACGCCCGCGAGCACCCCGGCCGCTAC
GCCGCGGCCCAGCTGCGGCTCACCCCGGCAGAGGCCGCCGCCAGCGCCGGCGGCAGGCAC
GCACAGATGACGCGGGCGATCCTGCGCGGCTACGAGCTGTCGGAGCCGGACCAGACGCAT
GCGGTCCGGCTGCTGGGCAGCGTCTTCCACGGCTACGTCAGCCTGGAGCTGGGAGGGGGG
TTCAGCCACAGTGCCCCCGACTCGCAGGAGACCTGGGAACGGATCCTGGACGGCCTCGAC
GCACTGCTGCGGAACTGGCCCGCGCAGGCCGCCCCGTCACCCGGCCCCGCAGACTCCGGA
CACCGAACGACACGTTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001647 DNA-binding HTH domain, TetR-type (Domain)
 [5-65]  PS50977
PS50977   HTH_TETR_2
 [11-53]  8.00000000000001e-07 PF00440
PF00440   TetR_N
IPR009057 Homeodomain-like (Domain)
 [4-75]  8.19999506482837e-12 SSF46689
SSF46689   Homeodomain_like
IPR011075 Tetracycline transcriptional regulator, TetR-related, C-terminal (Domain)
 [76-184]  3.60000433965927e-24 SSF48498
SSF48498   TetR_like_C
IPR015893 Tetracycline transcriptional regulator, TetR-like, C-terminal (Domain)
 [5-179]  4.2e-25 G3DSA:1.10.357.10
G3DSA:1.10.357.10   TetR_C
IPR025996 WHG domain (Domain)
 [84-159]  1.8e-06 PF13305
PF13305   WHG
SignalP No significant hit
TMHMM No significant hit