close all open/close all
Strply_00370 Strply_00370   last last

CDS information : Strply_00380


close this sectionLocation

Organism
StrainNRRL 2433 (=NBRC 13058)
Entry nameStreptolydigin
Contig
Start / Stop / Direction80,468 / 80,893 / + [in whole cluster]
80,468 / 80,893 / + [in contig]
Location80468..80893 [in whole cluster]
80468..80893 [in contig]
TypeCDS
Length426 bp (141 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in streptolydigin biosynthesis.
Note (GenBank)
  • ORF9
Reference
ACC
PmId
[19875077] Deciphering biosynthesis of the RNA polymerase inhibitor streptolydigin and generation of glycosylated derivatives. (Chem Biol. , 2009)

close this sectionSequence

selected fasta
>hypothetical protein [hypothetical protein]
MNENWTTTPVTAELLRGALEVERTEYGVLPHRLPARARAQCADGQLAMAEAQPSGVRLVF
RTRATTVELDALPTKRHYVGAPPRPDGVYDLLVDGRLAGQAGVAGGNTLTIDMTAGTFTH
EAGPAGTVRFSGLPDGDKDVEI
selected fasta
>hypothetical protein [hypothetical protein]
ATGAACGAGAACTGGACCACCACGCCCGTCACCGCGGAACTCCTGCGCGGCGCCCTGGAG
GTGGAGCGCACCGAGTACGGCGTGCTGCCGCACCGGCTGCCCGCCCGGGCCCGCGCCCAG
TGCGCCGACGGCCAACTGGCCATGGCCGAGGCCCAGCCCTCCGGCGTCCGGCTGGTCTTC
CGCACCCGGGCCACCACCGTCGAACTGGACGCCCTCCCCACCAAGCGGCACTACGTGGGC
GCGCCGCCCCGCCCGGACGGCGTGTACGACCTGCTCGTCGACGGCCGCCTGGCCGGCCAG
GCCGGTGTGGCGGGCGGCAACACCCTGACCATCGACATGACCGCCGGGACCTTCACGCAC
GAGGCGGGCCCCGCCGGCACCGTCCGTTTCAGCGGCCTGCCCGACGGCGACAAGGACGTC
GAGATC

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP
 [1-39]  0.167 Signal
Bacteria, Gram-negative   
TMHMM No significant hit
Strply_00370 Strply_00370   last last