close all open/close all
first first   Tatmc_00020 Tatmc_00020

CDS information : Tatmc_00010


close this sectionLocation

Organism
StrainCK4412
Entry nameTautomycetin
Contig
Start / Stop / Direction2,908 / 1,385 / - [in whole cluster]
2,908 / 1,385 / - [in contig]
Locationcomplement(1385..2908) [in whole cluster]
complement(1385..2908) [in contig]
TypeCDS
Length1,524 bp (507 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)TMC biosynthetic enzyme L7
GenetmcI
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in tautomycetin biosynthesis.
Note (GenBank)
  • hypothetical protein; ORF L7
Reference
ACC
PmId
[17379718] Isolation of the biosynthetic gene cluster for tautomycetin, a linear polyketide T cell-specific immunomodulator from Streptomyces sp. CK4412. (Microbiology. , 2007)
Related Reference
ACC
C6ZCS8
PmId
[19191560] Characterization of the tautomycetin biosynthetic gene cluster from Streptomyces griseochromogenes provides new insight into dialkylmaleic anhydride biosynthesis. (J Nat Prod. , 2009)

close this sectionSequence

selected fasta
>hypothetical protein [TMC biosynthetic enzyme L7]
MTEQVSAAAPHYEAPLVIGTEATPPIAWRPVLITAAVVAAVITAVSWRVGAYSNELYFIG
AGGHPAWGYVDQPPLTPVLAHGLWSVAHSLVLLRLPATLCMVAMVVLSALTARELGGERR
AQTVAALTTATSILLLSLSATLATTAIDSALWATVLWLVARWNRLRQDRLLLVATLVTAV
ALENKYLIVSLWAVLIVAVLVSGPRELLRRPLLWVGGAVAILSAVPGLLWQASHGWPQIE
MTSVIAAEAQRDAGGRLGFLPLVLFYAGIPVGVALAVRGVVRLWRIPAHRFLGITVGGVV
LAFLIADGRHTYTGGLLPLLFAAGSINLRGRVWRVVAGAPGLILAALIAVPLSLSVLPVS
TGAQVNILTRGSTGWPELVDTVAAAYRSAGPGPVALVADTYRQAGALDAYGESRGLPKAS
SPDRGYSAFGPPADEVTTVLWVGDRPPAEFRAAFAEVREVARFDDNPDGYLGINSDVPVW
LCTGFHDDWQQLWPRIKHYDSRDRVAA
selected fasta
>hypothetical protein [TMC biosynthetic enzyme L7]
ATGACCGAGCAAGTCAGCGCCGCCGCGCCGCACTACGAGGCCCCACTGGTCATCGGCACC
GAAGCCACGCCGCCGATCGCCTGGCGGCCGGTGCTCATCACCGCGGCGGTGGTCGCGGCC
GTGATCACCGCGGTCAGCTGGCGGGTCGGCGCGTACAGCAACGAGCTCTACTTCATCGGC
GCGGGCGGCCATCCGGCCTGGGGCTACGTGGACCAGCCGCCGCTCACCCCGGTGCTGGCC
CACGGCTTGTGGTCCGTCGCGCACTCGCTCGTGCTGCTGCGGCTGCCGGCCACCCTGTGC
ATGGTCGCCATGGTCGTGTTGAGCGCGCTCACCGCGCGCGAGTTGGGCGGTGAGCGCCGT
GCCCAGACGGTGGCGGCCCTGACCACGGCCACGTCGATCCTGCTGCTGTCGCTGAGCGCC
ACGCTGGCGACGACGGCGATCGACTCGGCGCTGTGGGCGACGGTGCTGTGGCTGGTCGCC
CGCTGGAACCGCCTGCGCCAGGACCGGCTGCTGCTGGTCGCCACCCTGGTCACCGCGGTG
GCACTGGAGAACAAGTACCTGATCGTCTCGCTGTGGGCCGTCCTGATCGTCGCCGTGCTC
GTCTCCGGCCCGCGGGAACTCCTGCGCCGCCCGCTGCTGTGGGTCGGTGGCGCCGTGGCG
ATCCTCAGCGCCGTGCCGGGTCTGCTCTGGCAGGCGAGCCACGGCTGGCCGCAGATCGAG
ATGACGAGCGTCATCGCGGCCGAGGCGCAGCGGGACGCCGGTGGGCGGCTCGGCTTCCTG
CCGCTCGTGCTCTTCTACGCCGGAATCCCAGTCGGTGTGGCCCTGGCGGTCCGCGGCGTC
GTGCGGCTGTGGCGCATCCCGGCCCACCGCTTCCTCGGCATCACCGTCGGCGGCGTTGTC
CTGGCCTTCCTGATCGCGGACGGCCGGCACACGTACACCGGCGGGCTGTTGCCCCTGCTC
TTCGCCGCGGGTTCGATCAATCTGAGAGGGCGCGTGTGGCGGGTGGTCGCCGGCGCCCCC
GGGCTGATCCTGGCGGCGCTCATCGCCGTGCCGCTGTCACTGTCGGTGCTCCCGGTGTCG
ACCGGGGCGCAGGTCAACATCCTGACCCGGGGCAGCACCGGCTGGCCGGAACTCGTCGAC
ACCGTCGCCGCGGCTTACCGGTCGGCGGGTCCGGGCCCGGTGGCCCTGGTCGCCGACACC
TACCGCCAGGCAGGTGCCCTGGACGCGTACGGGGAATCGCGCGGCCTGCCGAAGGCCAGC
AGCCCGGACCGCGGCTACTCCGCCTTCGGCCCGCCCGCGGACGAGGTGACCACGGTGCTG
TGGGTCGGAGACAGGCCCCCGGCCGAATTCCGTGCCGCGTTCGCCGAGGTGCGTGAGGTA
GCCCGCTTCGACGACAACCCGGACGGCTACCTCGGCATCAACTCCGACGTTCCGGTGTGG
CTGTGCACCGGATTCCACGATGACTGGCAGCAGCTGTGGCCGCGAATCAAGCACTACGAC
AGCCGGGACCGCGTCGCCGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP
 [1-40]  0.232 Signal
Eukaryota   
TMHMM
 [30-52]  Transmembrane (i-o) [90-112]  Transmembrane (o-i) [125-147]  Transmembrane (i-o) [186-204]  Transmembrane (o-i) [211-233]  Transmembrane (i-o) [259-281]  Transmembrane (o-i) [288-306]  Transmembrane (i-o) [311-328]  Transmembrane (o-i) [335-357]  Transmembrane (i-o)
Transmembrane 9   
first first   Tatmc_00020 Tatmc_00020