close all open/close all

CDS information : Tatmc_00020


close this sectionLocation

Organism
StrainCK4412
Entry nameTautomycetin
Contig
Start / Stop / Direction3,613 / 3,056 / - [in whole cluster]
3,613 / 3,056 / - [in contig]
Locationcomplement(3056..3613) [in whole cluster]
complement(3056..3613) [in contig]
TypeCDS
Length558 bp (185 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)TMC biosynthetic enzyme L6
Gene
Gene (GenBank)tmcH
EC number
Keyword
Note
Note (GenBank)
  • hypothetical protein; ORF L6
Reference
ACC
PmId
[17379718] Isolation of the biosynthetic gene cluster for tautomycetin, a linear polyketide T cell-specific immunomodulator from Streptomyces sp. CK4412. (Microbiology. , 2007)
Related Reference
ACC
C6ZCS7
PmId
[19191560] Characterization of the tautomycetin biosynthetic gene cluster from Streptomyces griseochromogenes provides new insight into dialkylmaleic anhydride biosynthesis. (J Nat Prod. , 2009)

close this sectionSequence

selected fasta
>hypothetical protein [TMC biosynthetic enzyme L6]
MALLGKLLKNRRAGETGLAWHAPHLAGAETLAVTSPDFGHETTLPVVHANRKLGGEDASP
ALAWTAAPAGTAQLLLVVEDPDAPTPKPFNHGVFLIEPSVTSLARGALDGTSPAAGVRPL
RSGKGVGYLGPAPIKSHGPHRYAFQLFALGEPIAADVESAKPAAVLAAAGSVLARGRIDG
FYENP
selected fasta
>hypothetical protein [TMC biosynthetic enzyme L6]
ATGGCACTGCTCGGAAAGTTACTGAAGAACCGGCGCGCGGGTGAGACGGGCCTCGCCTGG
CACGCGCCGCACCTGGCAGGGGCCGAGACCCTGGCCGTGACCAGCCCCGACTTCGGCCAC
GAGACGACGCTCCCGGTGGTACACGCCAACCGCAAGCTGGGCGGGGAGGACGCCTCGCCC
GCGCTCGCCTGGACGGCGGCGCCCGCGGGCACGGCACAACTGCTGCTGGTCGTCGAGGAC
CCTGATGCGCCCACCCCCAAGCCGTTCAACCACGGCGTCTTCCTCATCGAACCGTCGGTG
ACGAGCCTCGCGCGGGGCGCGCTCGACGGCACCAGCCCGGCGGCGGGTGTACGGCCGCTG
CGGTCCGGCAAGGGCGTCGGCTACCTGGGGCCGGCCCCGATCAAGAGCCACGGCCCGCAC
CGGTACGCCTTCCAGCTCTTCGCCCTCGGCGAGCCGATCGCCGCGGACGTGGAGAGCGCC
AAGCCCGCGGCCGTGCTCGCGGCGGCCGGCAGTGTGCTCGCGCGGGGTCGCATCGACGGT
TTCTACGAGAACCCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR008914 Phosphatidylethanolamine-binding protein PEBP (Family)
 [30-184]  6.8e-34 G3DSA:3.90.280.10
G3DSA:3.90.280.10   no description
 [30-184]  1.4e-31 SSF49777
SSF49777   PEBP-like
 [43-183]  5.1e-24 PF01161
PF01161   PBP
SignalP
 [1-28]  0.436 Signal
Bacteria, Gram-negative   
TMHMM No significant hit