close all open/close all

CDS information : Tatmc_00030


close this sectionLocation

Organism
StrainCK4412
Entry nameTautomycetin
Contig
Start / Stop / Direction4,735 / 3,713 / - [in whole cluster]
4,735 / 3,713 / - [in contig]
Locationcomplement(3713..4735) [in whole cluster]
complement(3713..4735) [in contig]
TypeCDS
Length1,023 bp (340 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.1 modification hydroxylation
Productputative hydroxylase
Product (GenBank)TMC biosynthetic enzyme L5
Gene
Gene (GenBank)tmcG
EC number
Keyword
  • dialkylmaleic anhydride moiety
  • C-3'
Note
Note (GenBank)
  • gamma-butyrobetaine; 2-oxoglutarate dioxygenase; ORF L5
Reference
ACC
PmId
[17379718] Isolation of the biosynthetic gene cluster for tautomycetin, a linear polyketide T cell-specific immunomodulator from Streptomyces sp. CK4412. (Microbiology. , 2007)
Related Reference
ACC
C6ZCS6
PmId
[19191560] Characterization of the tautomycetin biosynthetic gene cluster from Streptomyces griseochromogenes provides new insight into dialkylmaleic anhydride biosynthesis. (J Nat Prod. , 2009)
ACC
C0SMX2
NITE
Tauto_00190
PmId
[19281218] Functional characterization of ttmM unveils new tautomycin analogs and insight into tautomycin biosynthesis and activity. (Org Lett. , 2009)

close this sectionSequence

selected fasta
>putative hydroxylase [TMC biosynthetic enzyme L5]
MMSDQPWLHRLDPAEAAEIDDALDVLLKSGKPNFAASPADFPLPTLGPRLRGIVDSIENE
PGFALVRGVPVGDKSEDEVRRLYWGLGMYIGVPMIQNNNDSSMVDIRDERRAGKLRVHKS
NQHIGFHIDSTDVVTLLCRRAASQGGTSLVVSAEAVRREMSWECPELLSALYEPLPFADV
ASPDDERPDVFLSPVFGRHEGLTTTRFYIRRVLRSQDNPDAPRLTERQLEAINKVEEIAA
RPGLVTPMQFEPGDLQMINNHLVLHGRTAFASEEPGEGRHLLRMWFSVPSSRSLPPGYEA
AWGTREGGTLRGAGPRWQLQGEFGEFQRRQAEELGVAIPA
selected fasta
>putative hydroxylase [TMC biosynthetic enzyme L5]
GTGATGTCCGACCAACCGTGGCTGCACCGCCTGGACCCCGCCGAGGCGGCCGAGATCGAC
GACGCGCTGGACGTGCTGCTCAAGAGCGGCAAGCCGAACTTCGCCGCGAGTCCCGCCGAC
TTCCCACTGCCCACGCTGGGGCCGAGGCTGCGCGGCATCGTCGACTCCATCGAGAACGAG
CCGGGCTTCGCCCTGGTCCGGGGAGTTCCGGTCGGCGACAAGAGCGAGGACGAGGTCCGC
CGGCTCTACTGGGGACTCGGCATGTACATCGGCGTGCCCATGATCCAGAACAACAACGAC
TCCAGCATGGTCGACATCCGCGACGAGCGCCGGGCGGGCAAGCTGCGGGTTCACAAGTCG
AATCAGCACATCGGCTTCCACATCGACTCGACCGACGTCGTCACCCTGCTGTGCCGGCGG
GCGGCCTCGCAGGGCGGCACCAGCCTCGTGGTCAGCGCCGAGGCCGTACGCCGGGAGATG
TCCTGGGAGTGCCCCGAGCTGCTGAGCGCGCTGTACGAGCCGCTGCCCTTCGCTGACGTC
GCCTCCCCCGACGACGAGCGTCCGGACGTCTTCCTGAGCCCGGTCTTCGGTCGGCACGAA
GGGCTCACCACGACCCGGTTCTACATCCGCCGGGTGCTGCGCAGCCAGGACAACCCTGAC
GCGCCGCGGCTGACCGAGCGGCAGCTCGAGGCCATCAACAAGGTCGAGGAGATCGCCGCC
CGGCCCGGCCTGGTCACGCCCATGCAGTTCGAGCCGGGCGACCTGCAGATGATCAACAAC
CACCTGGTGCTGCACGGCCGCACGGCCTTCGCCAGCGAGGAGCCCGGGGAGGGACGGCAC
CTGCTGCGGATGTGGTTCTCCGTGCCGTCGAGCCGGTCGTTGCCGCCCGGGTACGAGGCG
GCGTGGGGCACCCGCGAGGGCGGCACCCTTCGCGGCGCCGGCCCGCGCTGGCAACTGCAG
GGCGAGTTCGGCGAGTTCCAGCGCCGACAGGCGGAGGAACTGGGCGTGGCGATCCCGGCC
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003819 Taurine catabolism dioxygenase TauD/TfdA (Family)
 [40-285]  8.89999999999994e-30 PF02668
PF02668   TauD
SignalP
 [1-16]  0.091 Signal
Eukaryota   
TMHMM No significant hit