close all open/close all

CDS information : Tatmc_00040


close this sectionLocation

Organism
StrainCK4412
Entry nameTautomycetin
Contig
Start / Stop / Direction5,867 / 4,776 / - [in whole cluster]
5,867 / 4,776 / - [in contig]
Locationcomplement(4776..5867) [in whole cluster]
complement(4776..5867) [in contig]
TypeCDS
Length1,092 bp (363 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)TMC biosynthetic enzyme L4
Gene
Gene (GenBank)tmcF
EC number
Keyword
Note
Note (GenBank)
  • hypothetical protein; ORF L4
Reference
ACC
PmId
[17379718] Isolation of the biosynthetic gene cluster for tautomycetin, a linear polyketide T cell-specific immunomodulator from Streptomyces sp. CK4412. (Microbiology. , 2007)
Related Reference
ACC
C6ZCS5
PmId
[19191560] Characterization of the tautomycetin biosynthetic gene cluster from Streptomyces griseochromogenes provides new insight into dialkylmaleic anhydride biosynthesis. (J Nat Prod. , 2009)

close this sectionSequence

selected fasta
>hypothetical protein [TMC biosynthetic enzyme L4]
MTEQWAVLDPAIRPADPEAYLRAALQWHFGEDTGSPFWLRRAKSLDFDPLTDVRTYDDLT
LFPNIVDELRDIPVEDLVPRGYGPRPPAPKVFETGGTTGAPKRVILMPDWFESSIDRMLA
GPVFAGREPGNILIATPTGPHKIGGQYDDVVRRQNTIKFTIDVDPRWVKKLIARGENDQV
KAYVEHVLDQIEHVLTTQNVGLLVITPPLLRACSARPLLVELINTKVSVVFWGGAHMTAD
ERYELQHVHFPGVRMVSRYNSAMILEGAAERAGTGTGDHVIYDPYSPVVTFRVIDPETRE
TVDYGRRGQVVMNHVSKGFFAPNNLERDSAVRVPGPEGQFGDSVADPRPVETFGGERVIE
GIY
selected fasta
>hypothetical protein [TMC biosynthetic enzyme L4]
ATGACCGAGCAGTGGGCGGTGCTGGACCCGGCGATCCGCCCGGCCGACCCCGAGGCCTAT
CTCAGAGCTGCGCTGCAGTGGCATTTCGGCGAGGACACCGGGTCGCCCTTCTGGCTGCGG
CGGGCGAAATCGCTGGACTTCGACCCGCTGACCGACGTGCGTACGTACGACGATCTGACG
CTGTTCCCCAACATCGTCGACGAGCTGCGCGACATTCCCGTGGAAGACCTTGTCCCGCGG
GGGTACGGCCCCCGGCCCCCGGCGCCGAAGGTCTTCGAGACCGGCGGCACCACCGGCGCG
CCCAAGCGGGTGATCCTCATGCCGGACTGGTTCGAGAGCTCCATCGACCGGATGCTCGCC
GGGCCGGTGTTCGCCGGGCGGGAGCCGGGCAACATCCTGATCGCGACGCCGACCGGCCCG
CACAAAATAGGCGGCCAGTACGACGACGTGGTGCGTCGGCAGAACACGATCAAGTTCACC
ATCGACGTCGACCCGCGCTGGGTCAAGAAGCTCATCGCCCGGGGCGAGAACGACCAGGTC
AAGGCGTACGTGGAGCACGTACTGGACCAGATCGAGCACGTCCTGACGACTCAGAACGTC
GGGCTGCTGGTGATCACGCCGCCGCTGCTGCGCGCGTGCTCCGCACGTCCGCTGCTCGTC
GAGCTCATCAACACCAAGGTGAGCGTGGTGTTCTGGGGCGGCGCGCACATGACGGCCGAC
GAGCGCTACGAGCTGCAGCACGTGCACTTCCCGGGCGTACGCATGGTGAGCCGCTACAAC
AGCGCGATGATCCTCGAGGGGGCCGCCGAGCGCGCCGGGACCGGCACCGGCGATCACGTG
ATCTACGACCCGTACAGCCCGGTGGTGACCTTCCGGGTGATCGACCCGGAGACGCGGGAG
ACGGTGGACTACGGCCGGCGCGGGCAGGTCGTGATGAACCACGTGAGCAAGGGCTTCTTC
GCGCCCAACAACCTCGAGCGGGACTCCGCCGTACGCGTGCCTGGCCCGGAGGGGCAGTTC
GGCGACTCGGTGGCCGACCCCCGGCCGGTCGAGACGTTCGGTGGTGAGCGAGTGATCGAG
GGCATCTACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP No significant hit
TMHMM No significant hit