close all open/close all

CDS information : Tatmc_00050


close this sectionLocation

Organism
StrainCK4412
Entry nameTautomycetin
Contig
Start / Stop / Direction6,793 / 5,864 / - [in whole cluster]
6,793 / 5,864 / - [in contig]
Locationcomplement(5864..6793) [in whole cluster]
complement(5864..6793) [in contig]
TypeCDS
Length930 bp (309 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative lyase
Product (GenBank)TMC biosynthetic enzyme L3
Gene
Gene (GenBank)tmcE
EC number
Keyword
  • dialkylmaleic anhydride moiety
Note
Note (GenBank)
  • citrate lyase beta subunit; ORF L3
Reference
ACC
PmId
[17379718] Isolation of the biosynthetic gene cluster for tautomycetin, a linear polyketide T cell-specific immunomodulator from Streptomyces sp. CK4412. (Microbiology. , 2007)
Related Reference
ACC
C6ZCS4
PmId
[19191560] Characterization of the tautomycetin biosynthetic gene cluster from Streptomyces griseochromogenes provides new insight into dialkylmaleic anhydride biosynthesis. (J Nat Prod. , 2009)
ACC
P17725
PmId
[7830578] Klebsiella pneumoniae genes for citrate lyase and citrate lyase ligase: localization, sequencing, and expression. (Mol Microbiol. , 1994)
Family/Domain
FD
IPR005000

close this sectionSequence

selected fasta
>putative lyase [TMC biosynthetic enzyme L3]
MSTDETPRQVFRSCLYVPGHHPDRIARAYDTETDAVILDLEDAVPPPEKARAREIVAEAV
TTPAAKPTYVRVNPVSSGLCEDDIRAVAGAGLAGLRVAKVSSSEEVRLVAGVLDELGHPG
RIHVLIESAEALEHAYELATASERVTMVGLGESDLRADLNTTNEGPTMDSARARVIVAAR
AAGLPNPIQSVYAEPRDLRGLLVTSRHGRRLGFLGRMAIHPAQIPIIHDVYTPTTNEIDD
ALEVFAAADLAATESRSIAITAQGKMVGPPALARARQVLELATALDLIAEARTGTTPSPR
DTGSNGGSS
selected fasta
>putative lyase [TMC biosynthetic enzyme L3]
ATGAGCACCGACGAGACCCCGCGGCAGGTCTTCCGCAGCTGCCTCTACGTGCCCGGCCAT
CATCCGGACCGGATAGCCCGGGCCTACGACACCGAGACCGACGCGGTGATCCTCGACCTC
GAGGACGCCGTCCCCCCGCCGGAGAAAGCCCGGGCCCGCGAGATCGTGGCCGAGGCCGTC
ACGACCCCGGCCGCAAAGCCCACGTATGTCCGGGTGAACCCGGTGTCCTCGGGTCTGTGC
GAGGACGACATCCGGGCCGTGGCCGGCGCCGGGCTCGCGGGACTGCGGGTAGCGAAGGTC
TCCTCGTCCGAGGAGGTGCGGCTCGTCGCCGGCGTGCTCGACGAACTCGGCCATCCCGGC
CGAATCCACGTGCTCATCGAGTCGGCCGAGGCGCTGGAGCACGCATACGAGCTGGCCACC
GCGTCCGAGCGGGTGACGATGGTGGGCCTGGGCGAGTCCGACCTGCGTGCCGACCTCAAC
ACCACCAACGAGGGCCCGACCATGGACAGTGCCCGGGCCCGGGTGATCGTCGCCGCCCGC
GCCGCCGGCCTGCCCAACCCGATCCAGAGCGTCTACGCCGAGCCTCGGGACCTGCGCGGG
CTGCTGGTCACCAGCAGGCACGGCCGCCGGCTCGGGTTCCTCGGCCGGATGGCGATCCAC
CCGGCGCAGATCCCGATCATCCACGACGTCTACACCCCGACGACCAACGAGATCGACGAC
GCACTGGAGGTCTTCGCGGCCGCGGACCTCGCCGCCACGGAGAGCCGGTCGATCGCCATC
ACCGCGCAGGGCAAGATGGTCGGCCCGCCCGCCTTGGCCCGCGCCCGCCAGGTGCTGGAG
CTGGCCACCGCCCTCGATCTGATCGCGGAGGCCCGGACCGGGACCACCCCATCGCCACGT
GACACCGGGAGCAACGGAGGTTCTTCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005000 Aldehyde-lyase domain (Domain)
 [12-221]  8.1e-37 PF03328
PF03328   HpcH_HpaI
IPR011206 Citrate lyase, beta subunit (Family)
 [2-289]  1.39999277195148e-82 PIRSF015582
PIRSF015582   Cit_lyase_B
IPR015813 Pyruvate/Phosphoenolpyruvate kinase (Domain)
 [7-232]  7.40000780398342e-63 SSF51621
SSF51621   Pyrv/PenolPyrv_Kinase_cat
 [7-232]  1.29999999999998e-69 G3DSA:3.20.20.60
G3DSA:3.20.20.60   Pyrv/PenolPyrv_Kinase_cat
SignalP
 [1-28]  0.116 Signal
Bacteria, Gram-positive   
TMHMM No significant hit