close all open/close all

CDS information : Tatmc_00060


close this sectionLocation

Organism
StrainCK4412
Entry nameTautomycetin
Contig
Start / Stop / Direction7,941 / 6,790 / - [in whole cluster]
7,941 / 6,790 / - [in contig]
Locationcomplement(6790..7941) [in whole cluster]
complement(6790..7941) [in contig]
TypeCDS
Length1,152 bp (383 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative CoA transferase
Product (GenBank)TMC biosynthetic enzyme L2
Gene
Gene (GenBank)tmcD
EC number
Keyword
  • dialkylmaleic anhydride moiety
Note
Note (GenBank)
  • CAIB/BAIF family protein; ORF L2
Reference
ACC
PmId
[17379718] Isolation of the biosynthetic gene cluster for tautomycetin, a linear polyketide T cell-specific immunomodulator from Streptomyces sp. CK4412. (Microbiology. , 2007)
Related Reference
ACC
C6ZCS3
PmId
[19191560] Characterization of the tautomycetin biosynthetic gene cluster from Streptomyces griseochromogenes provides new insight into dialkylmaleic anhydride biosynthesis. (J Nat Prod. , 2009)
ACC
Q1KLK1
PmId
[16547052] Properties of succinyl-coenzyme A:L-malate coenzyme A transferase and its role in the autotrophic 3-hydroxypropionate cycle of Chloroflexus aurantiacus. (J Bacteriol. , 2006)
ACC
Q1KLK0
PmId
[16547052] Properties of succinyl-coenzyme A:L-malate coenzyme A transferase and its role in the autotrophic 3-hydroxypropionate cycle of Chloroflexus aurantiacus. (J Bacteriol. , 2006)

close this sectionSequence

selected fasta
>putative CoA transferase [TMC biosynthetic enzyme L2]
MSDTPPPLAGLTVIDASTLFAGPFAARLLGDYGAEVIKVEAPAGDPVRGFGHAQNDVSLL
WKVLGRNKKSVVLDLRESAGAESFLRLVRRADALIENFRPGTLERWGLGPEVLAEANPRL
VLARVTTFGQDGPYARRPGFGTLAEAMSGLAAMSGEPDGPPALPSFPLGDAVAGLHAALA
VLIGLRARDTNGTGQVADVAIAETLIGTLGAQLTVYEHLGVKPERIGNRSHNSAPRNVYR
CADGRWVAVSASALSIAERIVRLVGRPELVAEPWFATGSGRAAHREVLDDAVRSWIATRK
RDEVVTAFEKAQAAVAPIYEVDDVLNDPQFRARGLTVEVPDAELGTVRMPGLPFRLSATP
GRIDWAGPRVGEHTEEFTGETEA
selected fasta
>putative CoA transferase [TMC biosynthetic enzyme L2]
GTGTCGGATACTCCGCCCCCCTTGGCCGGTCTCACCGTGATCGACGCGTCCACGCTCTTC
GCGGGCCCCTTTGCTGCGCGGCTGCTCGGCGACTACGGTGCCGAGGTCATCAAGGTCGAG
GCGCCGGCCGGCGATCCCGTACGCGGGTTCGGTCACGCCCAGAACGACGTCTCGCTGCTG
TGGAAGGTGCTGGGCCGCAACAAGAAGAGCGTGGTGCTCGACCTGCGCGAGTCCGCGGGC
GCCGAGAGTTTCCTGCGCCTGGTGCGCCGCGCCGACGCGCTCATCGAGAACTTCCGGCCC
GGCACGCTGGAGCGCTGGGGACTCGGCCCGGAGGTGCTCGCCGAGGCGAATCCGCGGCTG
GTGCTGGCCCGGGTGACCACGTTCGGCCAGGACGGCCCGTACGCGCGGCGTCCTGGCTTC
GGCACGCTGGCCGAGGCGATGAGCGGGCTGGCCGCGATGTCCGGTGAGCCGGACGGCCCG
CCCGCGCTGCCGTCGTTCCCCCTGGGCGATGCCGTGGCCGGGCTGCACGCCGCCCTGGCG
GTCCTCATCGGGCTGCGCGCCCGCGACACGAACGGCACCGGTCAGGTCGCGGACGTCGCG
ATCGCGGAGACGCTGATCGGCACGCTGGGCGCCCAGCTCACCGTGTACGAGCACCTCGGC
GTCAAGCCCGAGCGGATCGGCAACCGCAGCCACAACAGCGCGCCCCGCAACGTCTACCGG
TGTGCGGACGGCCGCTGGGTGGCGGTGTCCGCGTCGGCGCTCTCGATCGCCGAGCGTATC
GTCCGGCTGGTCGGCCGCCCCGAGTTGGTCGCGGAGCCGTGGTTCGCCACCGGAAGCGGC
CGGGCCGCGCACCGCGAGGTGCTCGACGACGCCGTCCGGTCGTGGATCGCCACCCGCAAG
CGCGACGAGGTCGTCACCGCGTTCGAGAAGGCGCAGGCGGCGGTCGCCCCCATATACGAG
GTCGACGACGTCCTGAACGACCCGCAGTTCCGCGCCCGCGGCCTGACCGTGGAGGTGCCC
GACGCCGAGCTCGGCACCGTACGCATGCCGGGCCTGCCGTTCCGGCTGTCGGCCACCCCG
GGCCGGATCGACTGGGCCGGCCCACGCGTCGGCGAGCACACTGAGGAATTCACAGGAGAG
ACCGAGGCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003673 CoA-transferase family III (Family)
 [71-253]  1.7e-63 PF02515
PF02515   CoA_transf_3
IPR023606 CoA-transferase family III domain (Domain)
 [4-381]  9.6e-124 SSF89796
SSF89796   CoA-transferase family III (CaiB/BaiF)
 [2-317]  5e-102 G3DSA:3.40.50.10540
G3DSA:3.40.50.10540   no description
SignalP
 [1-26]  0.358 Signal
Bacteria, Gram-positive   
 [1-21]  0.312 Signal
Bacteria, Gram-negative   
TMHMM No significant hit