close all open/close all

CDS information : Tatmc_00070


close this sectionLocation

Organism
StrainCK4412
Entry nameTautomycetin
Contig
Start / Stop / Direction9,456 / 7,960 / - [in whole cluster]
9,456 / 7,960 / - [in contig]
Locationcomplement(7960..9456) [in whole cluster]
complement(7960..9456) [in contig]
TypeCDS
Length1,497 bp (498 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative esterase
Product (GenBank)TMC biosynthetic enzyme L1
Gene
Gene (GenBank)tmcC
EC number3.1.1.-
Keyword
  • dialkylmaleic anhydride moiety
Note
Note (GenBank)
  • type B carboxylesterase; ORF L1
Reference
ACC
PmId
[17379718] Isolation of the biosynthetic gene cluster for tautomycetin, a linear polyketide T cell-specific immunomodulator from Streptomyces sp. CK4412. (Microbiology. , 2007)
Related Reference
ACC
C6ZCS2
PmId
[19191560] Characterization of the tautomycetin biosynthetic gene cluster from Streptomyces griseochromogenes provides new insight into dialkylmaleic anhydride biosynthesis. (J Nat Prod. , 2009)
ACC
C0SMW5
NITE
Tauto_00120
PmId
[18708355] Characterization of the tautomycin biosynthetic gene cluster from Streptomyces spiroverticillatus unveiling new insights into dialkylmaleic anhydride and polyketide biosynthesis. (J Biol Chem. , 2008)
ACC
Q9L378
PmId
[11178722] Cloning and characterization of a bacterial cell-bound type B carboxylesterase from Bacillus sp. BP-7. (Curr Microbiol. , 2001)

close this sectionSequence

selected fasta
>putative esterase [TMC biosynthetic enzyme L1]
MKPPALVVPGPVPPWNYRRGSRPTRPRLRELTAMGDHFDRDLVVETSSGTVRGFLDRGTP
NWRGVPYGRVEQRFHPPVPALPGEPVDGRHWGPICWQLPIVAGRSPSSVFPDAAESEDCL
NLNVWSPGPDPGARRPVLVWLHFGSRAYGAGSTPMIDVWHFAARHNAVVVTPNYRLGPWG
WLYLGALDPEFEDSANLALLDQILMLRWVKDNIAAFGGDPDNVTVFGMSSGASDLGALLG
APAARGLFHKAASYSGAQAPMLEKDATEFAEEFLAAAGPLAATAAELAALPNVGLRTVHR
RLLKQSVSRAGGPIIIRYGPFVDGSVLPKAPLDALADGLMAGVALLVSNVAEEAGVWDAW
GAVDHAYSRVFAGSDQSVSHEEKVEQLSEYRWVGPARKLIAAHHQGGGTGWMQKFDYAPT
TNWQTALSYPEVARRPVHGADVASLFLDPEGEVGSEDDRAVAALDQAALLALARDGRAPW
TPWSPDNQTPHRIAAAAH
selected fasta
>putative esterase [TMC biosynthetic enzyme L1]
GTGAAACCACCAGCATTAGTGGTTCCGGGGCCGGTGCCGCCCTGGAACTATCGACGCGGG
TCTCGCCCCACCCGCCCTCGACTCCGGGAGCTGACAGCCATGGGTGACCATTTTGATCGC
GACTTGGTGGTGGAGACGTCGTCCGGCACGGTCCGGGGTTTCCTGGACCGCGGGACACCG
AACTGGCGGGGCGTGCCCTACGGCCGGGTCGAACAGCGTTTCCACCCGCCGGTGCCCGCG
TTGCCGGGCGAGCCGGTCGACGGCCGCCACTGGGGGCCGATCTGCTGGCAGCTGCCGATC
GTGGCCGGCCGGAGCCCGTCCTCGGTCTTCCCCGACGCCGCCGAGTCCGAGGACTGCCTC
AACCTGAACGTCTGGTCGCCCGGTCCGGACCCGGGCGCCCGGCGGCCGGTGCTGGTGTGG
CTGCACTTCGGCAGCCGGGCCTACGGTGCGGGGAGCACCCCGATGATCGACGTGTGGCAC
TTCGCCGCCCGGCACAACGCCGTCGTCGTGACCCCGAACTATCGGCTCGGCCCGTGGGGC
TGGCTCTATCTGGGCGCGCTGGACCCGGAGTTCGAGGACAGCGCCAACCTTGCCCTGCTC
GACCAGATCCTCATGCTGCGCTGGGTCAAGGACAACATCGCGGCCTTCGGCGGTGACCCG
GACAACGTCACCGTCTTCGGCATGTCTTCAGGCGCCTCCGACCTGGGCGCGCTGCTGGGC
GCTCCGGCGGCCCGAGGGCTGTTCCACAAGGCCGCCTCCTACAGCGGGGCGCAGGCGCCG
ATGCTGGAGAAGGACGCCACGGAGTTCGCCGAGGAGTTCCTGGCGGCCGCGGGCCCGCTG
GCGGCCACGGCGGCCGAGCTGGCCGCCCTGCCCAACGTCGGCCTGCGGACCGTGCACCGG
CGGCTGCTGAAGCAGAGCGTCTCGCGCGCCGGAGGCCCGATCATCATCCGGTACGGGCCC
TTCGTCGACGGCTCCGTCCTGCCCAAGGCGCCCCTCGACGCGCTGGCCGACGGTCTCATG
GCCGGAGTCGCCCTGCTGGTGTCCAACGTCGCTGAGGAGGCGGGTGTGTGGGACGCCTGG
GGTGCGGTCGACCACGCCTACTCGCGCGTCTTCGCCGGCAGTGACCAGTCGGTGTCGCAC
GAGGAGAAGGTGGAACAGCTGTCCGAGTACCGCTGGGTCGGGCCGGCCCGGAAGCTGATC
GCCGCCCATCACCAGGGCGGCGGGACCGGCTGGATGCAGAAGTTCGACTACGCGCCGACG
ACCAACTGGCAGACCGCGCTCTCCTATCCCGAGGTGGCAAGGCGGCCGGTGCACGGCGCT
GACGTGGCGTCGCTGTTCCTCGACCCCGAGGGCGAGGTCGGCTCCGAGGACGACCGCGCG
GTCGCCGCGCTGGACCAGGCCGCTCTGCTCGCCTTGGCCCGCGACGGTCGCGCGCCCTGG
ACGCCGTGGTCACCGGACAACCAGACCCCGCACCGGATAGCCGCCGCGGCACACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002018 Carboxylesterase, type B (Domain)
 [40-357]  1.10000000000001e-66 PF00135
PF00135   COesterase
IPR019826 Carboxylesterase type B, active site (Active_site)
 [216-231]  PS00122
PS00122   CARBOXYLESTERASE_B_1
SignalP No significant hit
TMHMM No significant hit