close all open/close all

CDS information : Tatmc_00080


close this sectionLocation

Organism
StrainCK4412
Entry nameTautomycetin
Contig
Start / Stop / Direction9,279 / 38,225 / + [in whole cluster]
9,279 / 38,225 / + [in contig]
Location9279..38225 [in whole cluster]
9279..38225 [in contig]
TypeCDS
Length28,947 bp (9,648 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)tautomycetin biosynthetic PKS
Gene
Gene (GenBank)tmcA
EC number
Keyword
Note
Note (GenBank)
  • polyketide type I; tmcA
Reference
ACC
PmId
[17379718] Isolation of the biosynthetic gene cluster for tautomycetin, a linear polyketide T cell-specific immunomodulator from Streptomyces sp. CK4412. (Microbiology. , 2007)
Related Reference
ACC
C6ZCS1
PmId
[19191560] Characterization of the tautomycetin biosynthetic gene cluster from Streptomyces griseochromogenes provides new insight into dialkylmaleic anhydride biosynthesis. (J Nat Prod. , 2009)

close this sectionPKS/NRPS Module

0 malonyl-CoA
1 methylmalonyl-CoA
2 malonyl-CoA
3 methylmalonyl-CoA
4 malonyl-CoA
5 methylmalonyl-CoA
KSQ125..492
AT646..917
ACP992..1066
KS1083..1450
AT1621..1926
dh1973..2120
KR2391..2567
ACP2668..2738
KS2757..3133
AT3296..3563
KR3882..4062
ACP4164..4234
KS4257..4634
AT4787..5091
dh5136..5299
kr5556..5712
ACP5793..5863
KS5890..6264
AT6415..6682
dh6761..6928
KR7215..7391
ACP7486..7560
KS7583..7958
AT8111..8415
DH8463..8626
ER8926..9232
KR9246..9425
ACP9527..9597

close this sectionSequence

selected fasta
>polyketide synthase [tautomycetin biosynthetic PKS]
MSRGPGNPGPCRTTSPPPSRDQNGHPWLSAPGVEGGWGETRVDSSRAAPAPEPLMLVVSR
RGRALPGGQQTSPVDYQVEECPALPAAVSLVLCPPKCGCRHPPPPERGIPLTGGCPMGAA
HADRLVAVVGLSCRLPHAENLDAFWELLRSGASGVTEVGDDRWPGQGDPARPAAVRHGGF
LPQVDTFDPGFFGISPREAVEMDPQQRLALELSWEALEHAGIVPGALRGEPVPVYVGVMA
DDYAKLRLADAGDDPDPYAQAGTQRALIANRISHFLGVQGESMAVDTGQSSSLVAVHLAC
EALLSGRATAALAGGVQLNLLEETALMAAKLGTLSADGQCYTFDARADGYVRGEGGGFVV
LKTLARALADGDHIHAVIRGTATNNGGSARGLSVPSAAAQEAVLRQAYERADVDPAQAQY
VELHGTGTKVGDPIEAEALGAVLGRGRSSAQPLVVGSVKTNIGHLEGAAGIAGLLKTVLM
IRHRSIVASLNFAEPNPAIRFEEWRLRVATAAAPWPGSEAEEPLLAGVSSFGIGGSNCHV
VLSSAPVPPAGSAASEPGASSGAGVVPWVLSGRSAEAVAAQAERLRARVESDPALRPADV
AWSLLHAREAFDHRAVVVGSDREQLLAGVRHVSPVAAGADPRVGVLFTGQGAQRVGMARG
LYERSPVFAAALDEILAELDPLLERSLAGVMWGDDPGLVDRTGWAQPALFAVEAALFAVL
RSYGVRPAFLLGHSIGEVTAAYVAGVWSLPDACRVVAARARLMQALPAGGAMATVQLPEA
DVIPLLPEGVAVAAVNTAGSVVVSGPRDAVEGLLASVSVKVTRLRVSHAFHSALMDPMLA
EFARVLESVEFREPRIPVVSNLTGVVGDELTSPGYWVRQVRGTVRFADGVRWLGEQGVSV
LVEAGPDGVLSGLVDNGAPMLRRKRDDSEAVLAAVGHLWANGVTVDWAPVFEGLDAQRVA
LPTYAFQRQRYWPGVERVSPTPKLAGRLQLESGRSLRDVVRESAAVVLGHHPDTALDTHR
TFRELGFDSLTGVELRNLLQSRTGIELAGSAVFDYPTVTRLAEHLAGRAEPATPQTAADV
TGDPIVLVGMACRFPGGVSDPDGLWRLVAEEADATGPFPTDRGWDLDRLQEVSATSRGGF
VAGVDGFDAAFFRISPREALATDPQQRLLLEVSWEALEQAGIDPGTLAGTPTGVFAGAYG
SGYGDLVSREQLQGHLLTGGAGSVISGRVAYALGLEGPAVSVDTACSSSLVAMHLAAQAL
RTGECNLALAGGVTVMATPEMFLEFTAQNGLAEDGRCRSFADSADGTGWSEGVGVVVMER
LSDAVRNGHEVLAVMRSSAVNQDGASNGLTAPNGPSQQRVIRQALAAAGLSSADVDAVEA
HGTGTRLGDPIEAQALLATYGQDRPGDRPLWLGSLKSNIGHAQAAAGVGGVIKMVMALRH
GVLPRTLHVDAPSTQVDWTQGDVRLLTDAVPWPETGRPRRAGVSSFGVSGTNAHVILEAP
EATEPATTDPAVAESNAGESVAAESVVAEPEARGGGVVPWIISGASDEAVRAQAARLLEH
VESVPELRPVDVAWSLISARAALTHRTAAVGADRDELLAGLRAVAAGEVVPRMVRPGDKV
VFVFPGQGAQWVGMAQELLGSSPVFASSMGECAEALEPFVDWSLVDVLGDESALRRVDVV
QPALWAVMVSLAAVWRSYGVEPAAVVGHSQGEIAAACVAGALSLSDGARVVALRSRAIAE
RLTGGGMMALSVPAAAARDLIADRPGLSLAVVNGPGATVVSGEAAALDRLQAYCDEHGIQ
ARRIAVDYASHSVLVEQIRDRLLTDLAAITPQTSKVPVVSSVTGELMDTVGWDAEYWFRN
LRNTVLFEQALTAASADVVVEVSPHPVLLPVIQDTVPVVGTLRRGEGGLQRLVTSVAQAH
AYGIAVDWSPVFAGRGAERVALPTYAFQHQRFWPAPSAAPADVTAAGLSAAEHPLLGAML
TLPQTDGVVFTSRLSLRTHPWLAAPAGEDVAVFPATGWVELALRAGDSVGSDRIDELVVE
APLVLPAQGGVQLQVALGAPGPGTSRRTVTVHARPDGQDEWTRLVSGVLSAGGARETGAW
GDGWPAPGATELDVESQPGLVHAWQLGDQIFAEVEVPGSAGAEAFGLHPALLDAALRAAA
FDGVPSEFTDVVLHARGAERLRVVLTRTAPTEVAVEAADGTGAPVLAIGSVVMRPLTAES
LTIGTGDAALLTWEWTDVPVPSAAPIDDWTAVGPHGFTRRSGTPQAVVLSVSGDGEPVPT
AVHELTGWVLEQLQHQLNEGTTPLVVVTQGAVAPVVTDVAAAAVWGLVRSAQSENPGRIV
LLDTDAEVDGALLGRVLAAGEPQLVLRDGTWRAARLARATAESSPAPEVTGTVLVTGGTG
GLGGLIARHLVVAHGVRDLVLLSRRGPDAPGAAVLVTDLEEHGATVKVVACDVADRAALA
DVLAAHTIGGVVHAAGILDDGVINTLTREQLNRVLAPKADAAWHLHELTRELDLSLFVMF
SSVAGLIGSGGQGNYAAGNAFLDALMQLRRHDGLPGLALAWGPWTDELGLTGGLSGADLR
RIARSATPPLAVDQGLALFDRALRSDRPLLALTRFNPRAMRAQGEVPPLWRTLVGGTVRR
TADNSGSSRDGLQERLAGLSGDQARALLVELVGDAAATVLGHASGTRINTGQPFKELGFD
SLTAVELRNLLQSRTGRALPSSVVFDYPTVTRLAAFLAGEIAPVRAAAPLPVPVADDPVV
LVGMACRYPGGVTGPDELWDLVAAGVDGITPFPADRGWDLDGLLGSGETGSGSSATGEGG
FLEGVDGFDAAFFSISPREARATDPQQRLLLEVSWEALEQAGIDPHSLAGSPTGVFAGVY
SSGYADLVARGGEQLQGHQITGGAASVISGRVAYALGLEGPAVSVDTACSSSLVAMHLAA
QALRAGECSLALAGGVTVMATADAFVGFTAQGGLSPDGRCRSFADSAEGTGWSEGVGVVV
LERLSDARRNGHEVLAVFRSSAVNQDGASNGLTAPNGPSQQRLIRQALAAAGLSSADVDA
VEAHGTGTRLGDPIEAQALLSTYGQDRPGDRPLWLGSLKSNIGHTQAAAGVGGVIKMVMA
LRHGILPRTLHVDAPTSQVDWTEGNVRLLTGAVPWPETGRPRRAGVSSFGVSGTNAHVIL
EAPSVSSTSPAPAGVAADGSGAGEVVSGGREARVAVPWVLSARTAEAVRAQAARLVEHVE
ADPSLRPVDVGWSLVDTRAVFDHRAVVVGSDREQLLAGVRHVSPVAAGADPRVGVLFTGQ
GAQRVGMARGLYERSPVFAAALDEILAELDPLLERSLAGVMWGDDPGLVDRTGWAQPALF
AVEAALFAVLRSYGVRPAFLLGHSIGEVTAAYVAGVWSLPDACRVVAARARLMQALPAGG
AMATVQLPEADVIPLLPEGVAVAAVNTAGSVVVSGPRDAVERLLASVSVKVTRLRVSHAF
HSALMDPMLAEFARVLESVEFREPRIPVVSNLTGVVGDELTSPGYWVRQVRGTVRFADGV
RWLGEQGVSVLVEAGPDGVLSGLVDNSAPMLRRKRDDSEAVLAAIGHLWANGVTVDWAPV
FEGRDARRVKLPTYAFQHQRFWPEISAAAGDATSTGSRFDSELWASVEQQDTGTLAETLG
VDSALAASMLPALASWRDRHRDAETVNGWRYREAWKPLNIELSGARGGRWAVVVPAGRSD
DVLVDAVTGALGTDVTVVEHGDIPGLRAVDGIVSLEVLLQDSTQAGLTAVIDLLQTLPDQ
GIPLWVLTRGAVSTGAHDPVTDPDQAAVWGLGRVAALEQPACWGGLIDLPAVLDARAARE
LAVVLSNGSSEDQVAVRPAGVFGRRLRHAPAATGPAPWTTSGTVLITGGTGGLGAHVARW
AVERGAEHIVLASRRGPDAEGADMLRLELEAAGARVTVAACDVADRDALARILSEIPGEW
PLRTVVHAAGVMSDATPLAATTAEQVQHQVRVKVDGARNLDELTSGLDLDAFVLFSSGAA
AWGSGGQGPYAAGNAYLDALAAHRRAQSRTATSVAWGSWDEAGMLIGLAEAERENLDLLG
VIPMRPEPALSALQRTLHDDETTLVVTDMDWARFAPVFTAARPSALISDLPEVAAALTGT
GSTGTGEPGRHLAALPSAEREQALVDLVRAAAASVLGHSSSAQVDVDQPFKEQGFDSLTA
VELRNALLAGTGTSLPASAAFDYPTVTRLAAHLSAQFGEPEAAATPVVPVSAALTDDPIV
LVGMACRFPGGVQDPEGLWRLVAEGTDSITGFPADRGWNFDELLGTAGPGSGTIATGQGG
FLDEVAGFDAGFFRISPREALATDPQQRLLLEVSWEALEQSGIAPSTLVGSPTGVFVGAY
QNGYAEFAARSGEHELQGHLITGGAGSVISGRVAYALGLEGPAVSVDTACSSSLVAMHLA
AQALRSGECSLALAGGVMVMSTPDAFVGFTAQGGLAGDGRCKSFSDTADGTGWSEGVGVV
VMERLSDAERNGHEVLAVMRSSAVNQDGASNGLTAPNGPSQQRLIRQALAAAGLSSADVD
AVEAHGTGTRLGDPIEAQALLATYGQDRPGDRPLWLGSLKSNIGHAQAAAGVAGVIKMVM
ALRHGILPKTLHVDAPASQVDWTEGNVRLLTEAVPWPETDRPRRAGVSAFGVSGTNAHVI
LEAPARIDAEPPSEPATDGPLPWALSGKTGAAVQAQAARLLEHLESVPSLHPADVAWSLI
ASRESFDQRAVVVGADHDELRAGLRAIAVGSPAPGVVRGTRTGGRVVFVFPGQGAQWVGM
AQELIESSPVFASSMRECAEALEPFVDWSLADVLGDEAALQRVDVVQPALWAVMVSLAAV
WQSAGVSPSAVVGHSQGEIAAACVAGALSLSDGARVVALRSRAIAEHLTGGGMMALSVPA
AAARDLIADRPGVSLAAINGPSSVVVSGEADALDSLQAHCEEQGVRARRIAVDYASHSVL
VEQIRDRLLTDLAAITPQTSKVPVVSSVTGESMDTVGWDAEYWFRNLRNTVLFEQALTAA
GPGVIIEVSPHPVLLPAVQDIAPAVGTLRRGEGDLRRLLESVAQAHAYGVSVDWKRLVTG
RRVPLPTYAFQHQRFWPEPAAGPADVSAAGLSAAEHPLLGAMLPLPETGGVVFTSRLSLR
TQPWLADYAIRGAVVFPGTGYVELAVRAGDSVQCDRVDELVLEAPLVLPAQGGVQLQVVV
GEAAAGRRSVAVYARPDGQDEWTRHATGVLSASAGPAGPEFTAVGQAWPGPGATELDTRE
FYAELGTGGFAYGPLFQGLTRAWRDGDRILAEVELPEAGRGLAESFGIHPALLDAALQST
ALTGLAGLQFSFVDVVLRATGASRVRVALTRTGPDQVAIAIADNSGLPVLSIGSLTVRPL
AADSIVAGVGDGTLLSLQWVGIPAGTADARAAVVVPVSGDSGAVLTSAHELTARVVRKLD
ETTGPLVVVTRGAVAVEPGEPVTDLAAAAVWGVVRGMQTADPGRIVLLDTDTEVDGAVLS
QVLGADEPQLALRGGALRAARLVRHSSSTEPETVPSRVLVTGGTGTLGAAVARHLVAAHG
VRDLVLLSRRGSDAPGAAELAAELSQAGAAVELVACDLTDRQSLAEMLTAYPVGGLVHAA
RVDGPGQIDAAWHLHDLTRAFDLSLFVVFSSLAGIVGDENRPGDAFLAALMHQRHHDGLP
GLALAWGDWETDRGLSAPQAMVLFDRALSAGVPAVAPTRLNVQALRSQANLPAVWRALAG
GSSRRAATQAHGGRDGLGQRFAGLSAAERQQALIDLVRESAAAVLGYGSAAQLADDQPFS
DLGFDSLTAVDLRNTLRTRTGLNMPATLVFDYPTVARVAGYLAEELGEVSPAAASALVPA
APLPVAVADDPVVLVGMACRYPGGVTGPDELWDLVAAGADGITPFPADRGWDLDALLGVD
GSAASATAEGGFLAGAGEFDAAFFRISPREAQATDPQQRLLLEVSWEALEQAGIDPLSLA
GSSTGVFAGVYSSGYADLVARGGEQLQGHQITGGAASVISGRVAYTLGLEGPAVSVDTAC
SSSLVAMHLAAQALRAGECSLALAGGVTVMATPDAFVWFTVQGGLSPDGRCRSFADSADG
TGWSEGVGVVVMERLSDAVRNGHEVLAVMRSSAVNQDGASNGLTAPNGPSQQRVIRQALA
AAGLSSADVDAVEAHGTGTRLGDPIEAQALLATYGQDRPGDRPLWLGSLKSNIGHAQAAA
GVGGVIKMVMALRHGVLPRTLHVDEPSTQVDWTQGDVRLLTDAVPWPETGRPRRAGVSSF
GVSGTNAHVILEAPEATGPEPGPEPGPEPGVGGLVPWVLSGKTADAVRAQAARLLERVGS
DPSLRPLDVGWSLVDTRAVFDHRAVVVGGDREQLLAGLRNVSPAVAQTAPRLGVLFTGQG
AQRVGMARGLYERSPVFAAALDEIVAELDPLLERSLFGVMWGDDPGLVDRTGWAQPALFA
VEAALFAVLRSYGVRPAFLLGHSIGEVTAAYVAGVWSLPDACRVVAARARLMQALPAGGA
MATVQLPEADVVPLLPEGVAVAAVNTAGSVVVSGPRDAVERLLASVSVKVTRLRVSHAFH
SALMDPMLAEFARVLESVEFREPRIPVVSNLTGVVGDELTSPGYWVRQVRGTVRFADGVR
WLGEQGVSVLVEAGPDGVLSGLVDNSAPMLRRKRDDSEAVLAAIGHLWANGVTVDWAPAF
EGLHARRVKLPTYAFQHQRFWPEPVHQPTDVTAAGLSAAGHPLLGAMLPLPRTNGAVFTS
RLSLRTHPWLAEHTVDGAAVFPGSGYVELAVRAGDGVGCGHLDELVLEEPLVLPAQGGVQ
LQVVVGDDPAEAGTSRRSVTVYARRDDAESWTRHATGAVTATPAQATPAQAGPELDLVTG
AWPGPGATELDLAGFYDSVEYGPLFQGVTKAWRRAGHVIAEVAVPAEAGAESYGIHPALL
DAVLGTAKLTGVDGSPFGLTGVVLHAAGAAHLRVALTRTDDAAVSIAAADGAGQPVLSIG
SLSLRHLDTINITAVRGDRSLLRLDWIDIAATGSPVTKWVTADSTDQESAQVAVLSASAA
PDDVAASTHELVGRVLEQLQSWLTEATIPLVVLTRGAVAADPGEPVTDLAAAAVWGLVRS
AQTENPGRIVLLDMDADTNANADTGRDMGVDAALLGHVLASGEPQLALRNGTLRAARLTR
IEPTDQPPTPLEHAGTVLITGGTGGLGGVVARHLVGEHGVRSLLLLSRRGMAAAGAEELV
AELSGTGAAVEVVACDVTDRVALAEVIGAHDISGIVHTAGVVEDGVVATLSREQLDRVLA
PKVDAAWHLHELTRGLDLSMFVLFSSIGGLLGGGGQANYAAGNAFLDALVQQRRHDGLPG
VSMAWGPWTTEVGMVGTLSETNRRRMGRAALPALAVEHGLELFDEALRADLPLLAPTRLD
LRALRAQPEIPALWRALAGGPARRTAGAAPDGSVGQGLAALPPAEREKALVELVSESAAV
VLGHASAAQINAQQPFSELGFDSLTSVELRNLLQSRTELSLAASAVFDYPTVTRLAAHLA
GEIGEPDAAGPASVPAVGTVTDDPIVLVGMACRFPGDVQGPEDLWRLISEGTDGIGSFPT
DRGWDLDALLGPDGSGTGTSITAEGGFLTGIDEFDAAFFHISPREAQATDPQQRLLLEVA
WEALERTGITPSALAGSATGVFVGAYQTGYLDLVNRGHDDLRGHVLTGAATSVMSGRVAY
ALGLEGPAVSVDTACSSSLVAMHLAAQALRSGECSLALAGGVTVMATSDMFVGLTKQGGL
SADGRCRSFDDAADGTGWSEGVGVVVMERLSEARRNGHEVLAVFRASAVNQDGASNGLTA
PNGPSQQRVIRQALATAGLSPADVDAVEAHGTGTRLGDPIEAQALLATYGGDRPGDKPLW
LGSLKSNIGHTQAAAGVGGVIKMVMALRHGILPKTLHVTEPSTKVDWTQGDVRLLTEAVP
WPETGRPRRAGVSAFGISGTNAHIILEAPEPDPAGAGPETMPDVTPVVPWVVSGKTAAAV
RAQAARLLEHVESVPGLRPVDVGWSLLASRETFEYRAAVVSGDRDELLAGLRAISDDAVQ
PAPARFPDRVVFVFPGQGAQWVGMAQELLGSSPVFASSMGECAEALEPFVDWSLVDVLGD
ESALRRVDVVQPALWAVMVSLAAVWRSYGVEPAAVVGHSQGEIAAACVAGALSLSDGARV
VALRSRAIAERLTGGGMMALSVPAAAARDLIADRPGLSLAVVNGPGATVVSGEAAALDRL
QAYCDEHGIQARRIAVDYASHSVLVEQIRDRLLTDLAAITPQTSKVPVVSSVTGELMDTV
GWDAEYWFRNLRNTVLFEQALTAAEPGVVIEISPHPVLLPVIQDTVPVVGTLRRGEGGLQ
RLVTSVAQAHAHGVSVDWTTLFAGHGARRVPLPTYAFQRGRFWPEPAGGPADFAAAGMSS
AEHPLLGAMVPLPHSDGVLFTSRLSLRTHPWLADHAVRGTVIFPGTGYVELAARAGDSVG
CAKLDELVLEAPLVLPAQGGVQVQVVVDAGETQRAVSVYARPEGQEEWTRHATGLLSADA
PETGDEFDAVRGNWPAPGGTELDTAGFYEQLTAAGFLVYGPIFQGLTRAWRHGDRILAEV
EVPAAAGPESYGLHPALLDAALHATVFAELDAARTGGLPFSFTDVILRATGASRLRVALT
RTGPDEVAIAVADGTGLPVLSIGSLVVRPAAAAGPVVGVGDGVLVTMSWTDTTATGAPVG
DWLLVDRNGTGHTTVETLDTVDSSPVVLAVAAGPGPVVDTTHELTGWVLEQLQHWLRKES
VAPLVVWTRGAVAAHPGESVGDLPAAAAWGLVRSAQSENPGRIVLLDTDAALDAAVLGRA
LATDEPQLALRGGQFQAARLTRVVPADELAVPGPDTPWRLGLTESGTLDGLALLPCPEAT
RPLAPHEVRLEVRAAGLNFRDVLNALGMYPGEPGPLGSEAAGVIVEVGSGVTGLAVGDRV
MGLAFGAFGPLVVTDHRLLVAMPAGWQFSTAASVPIVFLTAWYGLVDLAGLQAGESVLVH
AGSGGVGLAAVQIARHLGAEIFSTASPAKWPVLHEWGVAEDHVASSRDLDFHRRFTEGTG
GRGVDVVLNALAGEFVDASLDTLAPDGRFVEMGKTDVRSSEQLRDRHPGVCYQAFELMDA
GAVRVQAMLRELVELFEAGDLRPLPVADWDIRQAPAAFRYMSQAKHIGKLVLTVPAATRL
PVDNDGTVVITGSGGLGGLAARHLVREYGVRHLLLVSRRGAEAPGVPELVAELADEGATA
LVAACDLSDRQALAGVLASVPPDHPVTGVVHTAAVLEDGVIGSLTREKLDRALAPKVDAV
WHLHELTRDLDLSMFLVYSSLAGHLGSAGQGNYAAANVFLDALMRRRRRDGLPGLSLAWG
AWTTEVGRVGELSRGDLERITRSAMPLLGVEQGMELFDRALRTGHAVLGPARLNPQALRA
QPDVAPLWRNLAGGAPRLPAADNTRNGHEDLEQRLAGLSRADREKILTDLVRGSAATVLG
HSSAGRIDTDRSFSELGFDSLTSVELRNLLRTRTGRTLSSGVVFDYPTVTQLAGYVDSLF
APAEPSGDEDGPDGAVARRARPADDGPDEALLLDADVDDLINIALRDQ
selected fasta
>polyketide synthase [tautomycetin biosynthetic PKS]
GTGTCCCGCGGTCCAGGAAACCCCGGACCGTGCCGGACGACGTCTCCACCACCAAGTCGC
GATCAAAATGGTCACCCATGGCTGTCAGCTCCCGGAGTCGAGGGCGGGTGGGGCGAGACC
CGCGTCGATAGTTCCAGGGCGGCACCGGCCCCGGAACCACTAATGCTGGTGGTTTCACGG
CGGGGGAGAGCGCTCCCCGGCGGGCAGCAGACGTCGCCTGTGGACTACCAGGTTGAGGAA
TGCCCCGCGCTCCCGGCCGCGGTTAGCTTGGTCCTCTGCCCGCCGAAGTGCGGATGCCGT
CACCCCCCTCCGCCCGAGCGCGGAATCCCCCTGACCGGAGGTTGTCCGATGGGTGCTGCG
CATGCTGACCGTCTCGTCGCTGTGGTCGGTCTCTCGTGCCGCTTGCCCCACGCCGAGAAC
CTGGACGCCTTCTGGGAACTGCTACGTTCCGGGGCGTCGGGCGTCACCGAGGTCGGCGAC
GACCGGTGGCCCGGCCAGGGCGACCCGGCCAGGCCCGCTGCCGTACGCCACGGAGGCTTC
CTCCCGCAGGTCGACACCTTCGACCCGGGCTTCTTCGGCATCTCGCCGCGCGAGGCCGTC
GAGATGGACCCGCAGCAACGGCTCGCCCTGGAACTGAGCTGGGAGGCACTCGAGCACGCC
GGTATCGTCCCCGGCGCGCTGCGCGGCGAGCCGGTCCCCGTCTACGTCGGCGTGATGGCC
GACGACTACGCCAAACTGCGCCTGGCCGACGCCGGCGACGACCCCGACCCGTACGCGCAG
GCCGGCACCCAGCGCGCCCTGATCGCGAACCGCATCTCCCACTTCCTGGGCGTGCAAGGC
GAGAGCATGGCGGTCGACACCGGCCAGTCCTCGTCGCTGGTCGCCGTCCACCTGGCGTGC
GAGGCCCTGCTGAGCGGACGCGCGACCGCGGCGCTGGCCGGCGGCGTCCAGCTCAACCTG
CTCGAAGAGACCGCCCTCATGGCGGCGAAGCTCGGCACCCTGTCCGCGGACGGTCAGTGC
TACACCTTCGACGCACGGGCCGACGGCTACGTTCGCGGCGAGGGCGGCGGTTTCGTGGTC
CTCAAGACGCTGGCCCGCGCGCTCGCCGACGGCGACCACATACACGCCGTCATCCGCGGC
ACCGCGACGAACAACGGCGGCTCGGCCCGCGGCCTGTCCGTGCCCAGCGCGGCGGCGCAG
GAGGCGGTGTTGCGCCAGGCCTACGAGCGCGCGGACGTGGACCCGGCGCAGGCGCAGTAC
GTGGAGCTGCACGGCACCGGCACCAAGGTCGGCGACCCGATCGAGGCTGAAGCCCTCGGC
GCCGTCCTGGGCCGGGGCCGGTCGTCGGCGCAGCCGCTGGTCGTGGGCTCGGTGAAGACG
AACATCGGGCACCTCGAGGGGGCGGCCGGCATCGCCGGGCTACTCAAGACGGTGCTGATG
ATCCGGCACCGGTCCATCGTGGCCAGCCTGAACTTCGCGGAACCGAACCCGGCGATCCGG
TTCGAGGAGTGGCGGTTGCGGGTGGCGACGGCTGCCGCGCCGTGGCCGGGGTCCGAAGCG
GAGGAGCCGCTCCTGGCCGGGGTGTCGTCGTTCGGGATCGGGGGCTCGAACTGCCATGTC
GTGCTGAGCTCCGCGCCTGTCCCTCCCGCCGGGTCGGCCGCTTCGGAGCCGGGGGCCTCT
TCCGGGGCCGGCGTCGTGCCTTGGGTGCTGTCGGGTCGGTCGGCCGAGGCGGTGGCGGCG
CAGGCGGAGCGGTTGCGGGCGCGTGTCGAGTCGGATCCCGCGCTGCGGCCGGCGGATGTG
GCGTGGTCATTGCTGCATGCACGGGAAGCTTTCGATCATCGTGCCGTCGTGGTGGGCAGT
GACCGTGAGCAGCTTCTCGCCGGTGTGCGTCATGTGTCTCCGGTTGCTGCGGGGGCGGAT
CCGCGGGTGGGTGTGTTGTTCACCGGTCAGGGTGCGCAGCGGGTGGGTATGGCCCGGGGT
TTGTATGAGAGGTCGCCGGTGTTCGCGGCGGCGTTGGATGAGATCCTCGCGGAGTTGGAT
CCCCTGCTGGAGCGTTCTTTGGCCGGGGTGATGTGGGGTGATGATCCGGGTCTGGTGGAT
CGGACGGGGTGGGCGCAGCCGGCGCTTTTCGCGGTGGAGGCGGCGCTGTTCGCGGTGCTG
CGTTCGTATGGGGTGCGTCCGGCTTTTCTGCTGGGTCATTCCATTGGTGAGGTGACGGCT
GCGTATGTGGCGGGGGTGTGGTCGCTTCCTGATGCGTGTCGGGTGGTGGCGGCGCGGGCG
AGGCTGATGCAGGCGTTGCCGGCTGGTGGGGCGATGGCCACGGTCCAGTTGCCCGAGGCG
GATGTCATCCCGTTGTTGCCTGAGGGGGTGGCGGTCGCCGCGGTCAATACTGCGGGTTCG
GTGGTGGTGTCGGGTCCGCGGGATGCGGTGGAGGGGTTGCTGGCGTCGGTTTCGGTGAAG
GTGACGCGGCTGAGGGTGTCGCATGCGTTCCACTCGGCGTTGATGGATCCGATGCTGGCG
GAGTTTGCGCGGGTGTTGGAGTCGGTGGAGTTCCGGGAGCCGCGGATTCCGGTGGTGTCG
AACTTGACCGGTGTGGTGGGTGACGAGTTGACGTCGCCTGGTTATTGGGTGCGGCAGGTG
CGGGGCACGGTCCGGTTCGCCGATGGGGTGCGGTGGCTGGGTGAGCAGGGTGTGAGCGTG
TTGGTGGAGGCTGGTCCGGACGGGGTGTTGTCGGGGCTGGTGGACAACGGTGCACCGATG
CTGCGGCGCAAGCGTGACGACAGCGAGGCGGTGCTGGCCGCGGTCGGGCATCTCTGGGCG
AACGGCGTCACCGTGGACTGGGCGCCGGTGTTCGAGGGCCTGGACGCGCAGCGGGTGGCG
CTGCCGACCTACGCGTTCCAGCGGCAACGCTACTGGCCCGGCGTCGAGCGCGTGTCGCCC
ACGCCGAAACTCGCCGGCCGGCTTCAGCTGGAGAGCGGGCGATCCCTGCGTGACGTGGTC
CGGGAGTCCGCGGCCGTTGTCCTGGGCCACCACCCTGACACCGCGCTCGACACCCACCGC
ACGTTCCGAGAGCTCGGTTTCGACTCCTTGACAGGGGTCGAGCTGAGGAACCTGTTGCAG
AGCCGGACCGGCATCGAGCTGGCCGGCAGCGCGGTGTTCGACTACCCGACGGTCACCCGG
CTCGCGGAGCATCTCGCCGGCCGGGCCGAGCCGGCCACGCCGCAGACCGCGGCCGACGTC
ACCGGCGATCCGATCGTCCTGGTCGGCATGGCCTGCCGCTTCCCCGGCGGCGTGTCCGAC
CCGGACGGGCTGTGGCGCCTGGTCGCCGAGGAAGCCGACGCGACCGGGCCCTTCCCCACC
GATCGCGGCTGGGACCTGGACCGGTTGCAGGAAGTCTCCGCCACGAGCCGCGGCGGTTTT
GTAGCCGGCGTCGACGGCTTCGACGCGGCGTTCTTCCGCATCTCGCCGCGCGAGGCGCTG
GCCACTGATCCGCAGCAGCGGTTGCTGCTGGAAGTGTCGTGGGAAGCGCTGGAACAGGCG
GGAATCGATCCCGGAACGCTGGCGGGCACCCCGACCGGCGTCTTCGCCGGAGCCTACGGA
TCCGGCTACGGCGACCTCGTCTCCCGTGAGCAACTACAGGGACACCTGCTGACCGGCGGC
GCCGGCAGCGTCATCTCCGGCCGGGTGGCGTACGCCCTGGGGCTGGAAGGTCCCGCCGTC
AGCGTGGACACCGCCTGCTCGTCGTCGCTGGTGGCCATGCACCTCGCCGCGCAGGCTCTC
CGCACGGGGGAGTGCAACCTGGCGCTGGCCGGCGGCGTCACCGTGATGGCGACGCCCGAG
ATGTTCCTGGAGTTCACGGCACAGAACGGGCTCGCGGAAGACGGCCGGTGCCGGTCGTTC
GCCGACAGCGCTGACGGGACGGGTTGGTCCGAGGGCGTCGGTGTGGTGGTGATGGAGCGG
CTGTCCGACGCTGTGCGCAACGGCCACGAGGTTCTCGCGGTCATGCGGTCGAGTGCGGTG
AATCAGGACGGTGCGTCGAATGGTCTGACGGCTCCGAACGGTCCGTCTCAGCAGCGGGTG
ATCCGTCAGGCGCTGGCGGCGGCGGGTCTGTCGTCGGCTGACGTGGATGCGGTGGAAGCC
CATGGGACGGGCACCAGGCTCGGTGATCCGATCGAGGCGCAGGCGTTGCTGGCCACGTAT
GGCCAGGACCGTCCGGGCGACCGGCCGTTGTGGCTGGGGTCGTTGAAGTCGAACATCGGC
CATGCGCAGGCTGCCGCGGGTGTCGGTGGTGTGATCAAGATGGTCATGGCGCTGCGTCAT
GGGGTCCTGCCCAGGACTCTGCATGTCGATGCGCCGTCGACTCAGGTCGACTGGACGCAG
GGTGATGTGCGGCTGCTGACCGATGCGGTGCCGTGGCCGGAGACCGGTCGTCCGCGCCGT
GCCGGGGTGTCCTCGTTCGGTGTCAGTGGTACCAACGCGCATGTCATCCTCGAAGCCCCC
GAGGCAACCGAGCCCGCAACTACCGACCCCGCAGTCGCCGAATCCAACGCCGGCGAATCC
GTGGCCGCCGAATCTGTGGTCGCCGAGCCGGAGGCCAGGGGCGGCGGCGTGGTGCCGTGG
ATCATCTCGGGCGCGTCGGACGAGGCGGTGCGGGCACAGGCGGCCCGTCTTCTGGAACAC
GTGGAATCGGTTCCCGAACTGCGTCCGGTGGACGTGGCCTGGTCGCTGATCAGCGCGCGA
GCGGCCTTGACCCATCGGACCGCGGCAGTCGGCGCGGACCGGGACGAACTGCTGGCCGGC
CTGCGCGCCGTGGCCGCCGGCGAGGTCGTCCCGCGGATGGTCCGGCCCGGCGACAAGGTG
GTCTTCGTCTTCCCGGGTCAGGGTGCGCAGTGGGTGGGGATGGCTCAGGAGCTGCTCGGG
TCTTCGCCTGTCTTCGCCTCGTCGATGGGTGAGTGTGCGGAGGCTCTGGAACCGTTCGTG
GACTGGTCGCTGGTCGATGTGCTGGGTGACGAGTCGGCGTTGCGGCGGGTGGATGTCGTG
CAGCCGGCGTTGTGGGCGGTGATGGTGTCGCTGGCCGCGGTCTGGCGTTCGTACGGGGTG
GAACCGGCTGCGGTGGTGGGTCATTCGCAGGGCGAGATCGCGGCGGCGTGTGTGGCGGGT
GCGTTGTCGTTGTCCGATGGTGCCCGGGTGGTGGCGTTGCGGAGCAGGGCGATCGCGGAG
CGTCTGACCGGTGGCGGCATGATGGCGTTGTCGGTGCCGGCCGCGGCGGCGCGGGACTTG
ATCGCGGACCGGCCGGGGCTGTCCTTGGCGGTCGTCAACGGTCCGGGGGCCACGGTGGTC
TCGGGTGAGGCTGCGGCGCTTGACCGGTTGCAGGCGTACTGCGACGAGCACGGGATCCAG
GCGCGGCGGATTGCCGTGGACTATGCCTCGCATTCGGTGCTGGTGGAACAGATCCGGGAC
CGGTTGCTGACGGACCTGGCTGCCATCACCCCGCAGACGTCGAAGGTGCCGGTCGTCTCG
TCGGTGACCGGCGAGCTGATGGACACCGTGGGCTGGGACGCCGAGTACTGGTTCCGGAAC
CTGCGGAACACGGTCCTGTTCGAACAGGCACTGACGGCCGCGAGCGCGGACGTCGTGGTG
GAAGTGAGCCCGCACCCGGTGCTGCTGCCCGTCATCCAGGACACCGTCCCGGTGGTCGGA
ACGCTTCGGCGCGGTGAGGGCGGCCTGCAGAGGCTGGTGACATCGGTCGCGCAGGCACAC
GCGTACGGCATCGCGGTGGACTGGTCCCCGGTGTTCGCCGGCCGCGGTGCCGAGCGGGTC
GCCCTCCCGACGTACGCCTTCCAGCATCAGCGCTTCTGGCCCGCCCCCTCCGCCGCACCC
GCCGACGTGACCGCGGCCGGCCTCAGTGCCGCGGAACACCCGCTGCTGGGCGCCATGCTG
ACGCTGCCGCAGACCGATGGCGTGGTCTTCACCAGCCGGCTGTCGTTGCGGACCCACCCG
TGGCTGGCCGCTCCCGCCGGTGAGGACGTGGCCGTCTTCCCCGCCACGGGCTGGGTCGAG
CTGGCACTGCGCGCCGGTGACAGCGTGGGCTCCGACCGGATCGACGAGTTGGTCGTGGAG
GCGCCGCTGGTGCTGCCCGCCCAGGGCGGTGTGCAGCTGCAGGTAGCCCTCGGCGCGCCC
GGGCCCGGCACGTCGCGCCGGACGGTCACGGTGCACGCCCGACCCGACGGTCAGGACGAA
TGGACTCGACTCGTCTCCGGCGTGCTGAGCGCCGGCGGCGCACGGGAAACAGGGGCGTGG
GGAGATGGCTGGCCGGCGCCGGGCGCGACAGAGCTGGACGTCGAATCCCAGCCCGGCCTG
GTCCACGCCTGGCAGTTGGGCGACCAGATCTTCGCCGAGGTCGAGGTGCCCGGCTCGGCC
GGTGCGGAGGCGTTCGGTCTCCACCCGGCCTTGCTCGACGCCGCGCTGCGGGCCGCGGCC
TTCGACGGGGTGCCGTCCGAGTTCACCGACGTGGTCCTGCATGCCCGCGGCGCCGAGCGG
CTGCGTGTCGTTCTCACCCGCACCGCGCCCACCGAGGTGGCGGTGGAGGCCGCCGACGGC
ACAGGAGCGCCGGTCCTGGCGATCGGATCGGTCGTGATGCGGCCGCTCACGGCCGAATCA
CTGACCATCGGTACGGGCGACGCGGCGCTGCTGACGTGGGAGTGGACCGATGTTCCCGTC
CCGTCGGCCGCCCCGATCGACGACTGGACAGCGGTCGGCCCGCACGGTTTCACGCGGCGG
TCCGGCACACCGCAAGCGGTCGTGCTCAGCGTTTCCGGCGATGGGGAACCGGTTCCAACA
GCGGTCCATGAGCTGACCGGCTGGGTGCTGGAACAGTTGCAGCATCAGCTGAACGAGGGC
ACGACCCCGCTGGTCGTGGTCACACAGGGTGCGGTGGCGCCCGTGGTGACCGACGTGGCC
GCGGCGGCCGTGTGGGGCCTGGTGCGCTCGGCGCAGTCCGAGAACCCGGGCCGGATCGTG
CTGCTGGACACCGACGCCGAGGTCGACGGCGCACTGCTGGGCCGCGTCCTGGCCGCCGGC
GAGCCGCAACTGGTCCTGCGCGACGGAACCTGGCGCGCCGCCCGGCTGGCCCGTGCCACC
GCGGAGTCCTCGCCGGCTCCCGAGGTGACCGGGACGGTCCTGGTCACCGGCGGCACCGGC
GGCCTGGGCGGGCTGATCGCACGGCACCTCGTCGTCGCGCACGGCGTCCGCGACCTGGTG
CTGCTGAGCCGACGTGGCCCGGACGCGCCGGGGGCCGCCGTCCTGGTGACCGACCTGGAA
GAGCACGGCGCCACGGTGAAAGTCGTGGCCTGCGACGTTGCCGATCGGGCGGCCCTGGCG
GACGTGCTGGCTGCCCACACCATCGGTGGCGTGGTCCACGCGGCGGGCATCCTCGACGAC
GGCGTCATCAACACCCTGACACGGGAGCAGCTCAACCGCGTCCTGGCCCCGAAGGCGGAC
GCCGCCTGGCACCTGCACGAGCTGACCCGGGAACTCGACCTCTCCCTGTTCGTGATGTTC
TCCTCCGTCGCGGGACTCATCGGCAGCGGCGGCCAGGGCAACTACGCCGCCGGAAACGCC
TTCCTCGACGCGCTGATGCAGCTCCGCCGTCACGACGGCCTGCCCGGTCTCGCCCTGGCG
TGGGGCCCTTGGACCGACGAACTCGGCCTCACCGGCGGCCTGTCCGGTGCCGACCTCCGG
CGGATCGCCCGCTCGGCCACGCCGCCGCTCGCGGTGGACCAGGGGCTCGCCCTCTTCGAC
CGGGCACTGCGCAGCGATCGTCCCCTGCTGGCGCTGACCCGCTTCAACCCCCGGGCGATG
CGAGCGCAGGGCGAGGTGCCACCGCTGTGGCGCACCCTGGTGGGTGGCACCGTGCGCCGC
ACCGCGGACAACAGTGGCAGCAGTCGTGACGGGCTCCAGGAACGGCTCGCGGGCCTCTCC
GGCGACCAGGCCCGGGCCCTGCTGGTCGAGCTGGTCGGTGACGCGGCCGCGACCGTGCTG
GGGCACGCCTCCGGCACGCGGATCAACACCGGGCAGCCCTTCAAGGAGCTCGGCTTCGAC
TCGCTGACCGCGGTCGAGCTGCGCAACCTGCTGCAGTCCAGGACGGGACGGGCGCTGCCC
TCGAGCGTGGTCTTCGACTACCCGACGGTCACCCGGCTGGCCGCCTTCCTGGCCGGTGAG
ATCGCTCCCGTCCGGGCTGCCGCGCCGCTGCCGGTTCCGGTCGCCGACGACCCGGTCGTG
CTGGTCGGCATGGCCTGCCGTTACCCGGGAGGTGTCACGGGTCCGGACGAGTTGTGGGAC
CTGGTGGCGGCCGGGGTGGACGGGATCACGCCGTTCCCGGCCGATCGCGGCTGGGATCTG
GATGGGCTGCTGGGATCCGGGGAAACGGGTTCCGGATCCTCGGCAACCGGCGAGGGTGGC
TTTCTCGAGGGTGTCGATGGCTTCGATGCGGCGTTCTTCAGTATCTCGCCGCGCGAGGCG
CGTGCCACCGACCCTCAGCAGCGGTTGTTGCTGGAGGTGTCGTGGGAGGCGCTGGAACAG
GCGGGAATCGATCCCCACTCCCTGGCCGGCAGCCCCACCGGCGTGTTCGCCGGCGTCTAC
TCCTCCGGGTACGCCGATCTTGTCGCCCGTGGTGGGGAGCAGTTGCAGGGTCACCAGATC
ACGGGTGGCGCGGCCAGCGTGATCTCGGGGCGGGTTGCGTACGCGCTGGGGCTGGAGGGT
CCCGCGGTCAGTGTGGACACGGCGTGTTCGTCGTCGCTGGTGGCGATGCATCTGGCCGCG
CAGGCGCTGCGGGCGGGGGAGTGTTCGTTGGCGCTGGCCGGCGGCGTCACCGTCATGGCC
ACTGCGGATGCCTTCGTGGGCTTCACCGCGCAGGGTGGTCTGTCCCCGGACGGCCGGTGC
CGGTCGTTCGCCGACAGCGCTGAGGGGACGGGCTGGTCCGAGGGCGTCGGCGTGGTGGTG
TTGGAGCGGCTGTCCGATGCTCGCCGTAACGGTCACGAGGTGCTTGCCGTGTTCCGGTCG
AGTGCGGTGAATCAGGACGGTGCGTCGAATGGTCTGACGGCTCCGAACGGTCCGTCTCAG
CAGCGTTTGATCCGTCAGGCTCTGGCGGCGGCGGGTCTGTCGTCGGCTGATGTGGATGCG
GTGGAGGCCCATGGGACGGGCACCCGCCTCGGTGATCCGATCGAGGCGCAGGCGCTGCTG
TCCACGTATGGTCAGGACCGTCCCGGCGATCGCCCGTTGTGGCTGGGGTCCCTGAAGTCG
AACATCGGTCACACTCAGGCTGCCGCGGGTGTCGGTGGTGTGATCAAGATGGTCATGGCG
CTGCGTCACGGGATCCTGCCCAGGACCCTGCACGTGGACGCGCCGACCTCGCAGGTGGAC
TGGACCGAGGGGAATGTGCGGCTGCTGACCGGCGCGGTGCCGTGGCCGGAGACCGGTCGT
CCGCGCCGTGCCGGGGTGTCCTCGTTCGGTGTCAGTGGCACCAACGCCCACGTCATCCTG
GAAGCGCCGTCTGTGTCGTCCACGTCGCCTGCGCCGGCCGGTGTTGCGGCCGATGGGTCC
GGGGCGGGCGAGGTGGTGAGTGGTGGGCGTGAGGCGCGTGTTGCGGTGCCGTGGGTGTTG
TCTGCCAGGACGGCTGAGGCGGTGCGTGCTCAGGCGGCGAGGCTGGTGGAGCATGTGGAA
GCGGATCCGTCGTTGCGGCCGGTGGATGTCGGCTGGTCGTTGGTGGATACGCGTGCGGTG
TTCGATCACCGTGCCGTCGTGGTGGGCAGTGACCGTGAGCAGCTTCTCGCCGGTGTGCGT
CATGTGTCTCCGGTTGCTGCGGGGGCGGATCCGCGGGTGGGTGTGTTGTTCACCGGTCAG
GGTGCGCAGCGGGTGGGTATGGCCCGGGGTTTGTATGAGAGGTCGCCGGTGTTCGCGGCG
GCGTTGGATGAGATCCTCGCGGAGTTGGATCCCCTGCTGGAGCGTTCTTTGGCCGGGGTG
ATGTGGGGTGATGATCCGGGTCTGGTGGATCGGACGGGGTGGGCGCAGCCGGCGCTTTTC
GCGGTGGAGGCGGCGCTGTTCGCGGTGCTGCGTTCGTATGGGGTGCGTCCGGCTTTTCTG
CTGGGTCATTCCATTGGTGAGGTGACGGCTGCGTATGTGGCGGGGGTGTGGTCGCTTCCT
GATGCGTGCCGGGTGGTGGCGGCGCGGGCGAGGCTGATGCAGGCGTTGCCGGCTGGTGGG
GCGATGGCCACGGTCCAGTTGCCCGAGGCGGATGTCATCCCGTTGTTGCCTGAGGGGGTG
GCGGTCGCCGCGGTCAATACTGCTGGTTCGGTGGTGGTGTCGGGTCCGCGGGATGCGGTG
GAACGGCTGCTGGCGTCGGTTTCGGTGAAGGTGACGCGGCTGAGGGTGTCGCATGCGTTC
CACTCGGCGTTGATGGATCCGATGCTGGCGGAGTTTGCGCGGGTGTTGGAGTCGGTGGAG
TTCCGGGAGCCGCGGATTCCGGTGGTGTCGAACTTGACCGGTGTGGTGGGTGACGAGTTG
ACGTCGCCTGGTTATTGGGTGCGGCAGGTGCGGGGCACGGTCCGGTTCGCCGATGGGGTG
CGGTGGCTGGGTGAGCAGGGTGTGAGCGTGTTGGTGGAGGCTGGTCCGGACGGGGTGTTG
TCGGGGCTGGTGGACAACAGTGCACCGATGCTGCGGCGCAAGCGTGACGACAGCGAGGCG
GTGCTGGCCGCGATCGGGCATCTCTGGGCGAACGGCGTCACCGTGGACTGGGCGCCGGTG
TTCGAGGGTCGGGACGCGCGGCGGGTCAAGCTGCCGACGTATGCGTTCCAGCACCAGCGC
TTCTGGCCCGAGATCAGCGCGGCCGCCGGCGACGCGACGAGCACCGGGAGTCGGTTCGAC
AGTGAGCTCTGGGCGTCCGTGGAGCAGCAGGACACCGGGACCCTCGCGGAAACCCTGGGC
GTCGACAGTGCGCTGGCCGCGTCGATGCTGCCGGCTCTGGCGTCGTGGCGTGACCGGCAT
CGCGACGCAGAGACCGTGAACGGCTGGCGCTACCGGGAAGCCTGGAAGCCGCTGAACATC
GAGCTCTCCGGAGCCAGAGGCGGCCGTTGGGCCGTGGTCGTTCCGGCGGGAAGGAGCGAC
GACGTGCTCGTCGACGCCGTGACCGGTGCACTGGGAACCGATGTCACCGTGGTGGAACAC
GGCGACATCCCCGGACTGCGCGCAGTCGATGGCATCGTCTCTCTGGAAGTCCTGCTGCAA
GACAGCACGCAAGCAGGCCTCACCGCCGTCATCGACCTGCTGCAAACGCTGCCGGATCAA
GGGATCCCGCTGTGGGTGCTGACCCGGGGAGCGGTGTCGACCGGCGCCCATGATCCGGTT
ACCGATCCCGATCAGGCCGCCGTCTGGGGACTGGGACGGGTCGCCGCTCTGGAGCAGCCC
GCCTGCTGGGGTGGTCTGATCGACCTGCCCGCGGTTCTCGACGCCCGCGCTGCCCGCGAG
CTGGCCGTCGTACTGTCGAACGGCTCGAGTGAGGACCAGGTCGCCGTCCGCCCGGCCGGA
GTGTTCGGGCGCCGGTTGAGGCACGCTCCGGCCGCGACCGGTCCGGCGCCGTGGACCACG
TCCGGAACCGTCCTCATCACCGGGGGTACGGGTGGCCTGGGGGCGCACGTCGCACGGTGG
GCAGTCGAGCGCGGGGCCGAGCATATTGTCCTGGCGAGCCGGCGCGGGCCGGACGCGGAA
GGCGCCGACATGCTGCGCCTGGAGCTCGAGGCGGCCGGCGCCCGGGTCACGGTGGCAGCC
TGTGACGTCGCCGACCGCGACGCCCTGGCCCGGATCCTCAGCGAGATTCCCGGTGAATGG
CCCCTGCGTACGGTCGTGCACGCCGCCGGCGTCATGAGCGATGCCACTCCGCTCGCCGCG
ACCACCGCGGAGCAGGTGCAGCACCAGGTGCGAGTGAAGGTCGACGGCGCCCGGAACCTC
GACGAGCTGACCAGCGGCCTCGACCTCGACGCGTTCGTCCTGTTCTCCTCCGGCGCGGCT
GCCTGGGGCAGCGGCGGCCAGGGTCCGTACGCGGCCGGCAACGCCTATTTGGACGCGCTG
GCCGCTCACCGCCGGGCGCAGAGCCGCACGGCCACCTCGGTGGCGTGGGGCTCGTGGGAC
GAGGCCGGCATGCTGATCGGCCTGGCCGAGGCGGAGCGGGAGAACCTCGACCTGCTGGGT
GTGATCCCCATGCGGCCCGAGCCCGCTCTCAGCGCGTTGCAGCGCACCCTGCACGACGAC
GAGACCACGCTCGTGGTCACGGACATGGACTGGGCCCGGTTCGCCCCGGTCTTCACCGCC
GCCCGGCCGAGCGCCCTGATTTCCGACCTGCCCGAGGTGGCCGCCGCCCTGACGGGAACC
GGTTCCACGGGTACGGGTGAGCCGGGCCGCCACCTCGCCGCCCTGCCCTCGGCTGAGCGG
GAACAGGCCCTCGTCGATCTGGTACGCGCGGCGGCGGCCTCGGTGCTCGGTCACTCGTCC
AGCGCGCAGGTCGACGTGGACCAGCCGTTCAAGGAACAGGGCTTCGACTCGCTGACCGCG
GTCGAGTTGCGCAATGCCCTCCTGGCGGGAACAGGGACGAGCCTGCCGGCCAGTGCCGCG
TTCGACTATCCGACCGTCACCCGGCTGGCCGCCCACCTGTCCGCCCAGTTCGGCGAGCCG
GAAGCCGCAGCCACACCAGTGGTACCGGTCTCAGCCGCACTCACCGACGACCCGATCGTG
CTGGTCGGCATGGCCTGCCGCTTCCCGGGAGGCGTCCAGGACCCGGAGGGCCTTTGGCGC
CTGGTCGCCGAGGGGACGGACAGCATCACCGGCTTTCCCGCCGACCGGGGCTGGAACTTC
GATGAGCTGCTGGGTACCGCCGGGCCCGGTTCGGGAACCATCGCGACGGGACAGGGCGGC
TTCCTCGACGAAGTGGCCGGCTTCGACGCCGGATTCTTCCGCATCTCGCCCCGCGAGGCG
TTGGCCACCGACCCGCAGCAGCGGCTGTTGCTCGAGGTTTCCTGGGAAGCGCTGGAACAG
TCCGGAATTGCTCCCTCGACCCTGGTGGGCAGCCCCACGGGTGTCTTCGTCGGCGCCTAC
CAGAACGGGTACGCCGAGTTCGCCGCACGCTCCGGCGAGCACGAGCTGCAGGGCCACCTC
ATCACCGGGGGCGCCGGCAGTGTCATCTCCGGCCGGGTGGCGTACGCGCTCGGCCTGGAG
GGCCCCGCGGTCAGCGTGGACACCGCCTGCTCCTCGTCGCTCGTGGCGATGCATCTGGCC
GCGCAGGCCCTGCGATCCGGGGAGTGCTCGCTCGCCCTCGCCGGCGGTGTGATGGTCATG
TCCACCCCGGACGCCTTCGTGGGCTTCACCGCTCAGGGCGGCCTCGCCGGGGACGGCCGC
TGCAAGTCCTTCTCCGACACGGCCGACGGCACCGGCTGGTCCGAGGGCGTCGGCGTGGTG
GTGATGGAGCGTCTGTCCGACGCCGAGCGCAACGGCCATGAGGTCTTGGCGGTCATGCGC
TCGAGTGCGGTGAACCAGGACGGTGCGTCGAACGGTCTGACCGCGCCCAACGGCCCGTCC
CAGCAACGTTTGATCCGCCAGGCCCTGGCTGCTGCCGGTCTGTCGTCGGCCGACGTGGAC
GCGGTGGAGGCCCACGGTACGGGCACCCGCCTCGGTGATCCGATCGAGGCGCAGGCGCTG
CTGGCCACGTATGGCCAGGACCGTCCCGGCGACCGCCCGTTGTGGCTGGGCTCCCTGAAG
TCCAACATCGGCCACGCCCAGGCCGCGGCGGGTGTGGCCGGCGTCATCAAGATGGTCATG
GCGCTGCGTCACGGGATCCTCCCCAAGACCCTGCACGTGGACGCGCCGGCCTCCCAGGTG
GACTGGACCGAGGGGAATGTCCGGCTGCTCACCGAGGCGGTGCCCTGGCCGGAGACCGAC
CGTCCGCGCCGTGCCGGCGTGTCCGCGTTCGGTGTCAGCGGTACCAACGCGCATGTCATC
CTCGAAGCCCCGGCTCGCATCGACGCCGAGCCTCCGTCGGAACCCGCCACTGACGGCCCG
CTGCCATGGGCCCTGTCCGGGAAGACCGGCGCGGCGGTGCAGGCGCAAGCGGCGCGTCTC
CTGGAACACCTGGAATCGGTTCCCTCGCTGCACCCGGCGGACGTGGCCTGGTCGTTGATC
GCGTCTCGGGAATCCTTCGACCAGCGGGCCGTGGTGGTGGGCGCGGACCACGACGAGCTG
AGGGCCGGACTGCGTGCCATCGCCGTCGGCAGTCCCGCGCCCGGAGTGGTGCGCGGCACC
CGGACCGGCGGCCGGGTCGTGTTCGTGTTCCCGGGTCAGGGTGCGCAGTGGGTGGGGATG
GCTCAGGAGCTGATCGAGTCCTCGCCTGTCTTCGCCTCGTCGATGCGTGAGTGCGCGGAG
GCCCTGGAACCGTTCGTGGACTGGTCGCTGGCCGACGTGCTCGGCGACGAAGCTGCGCTG
CAGCGGGTGGATGTCGTGCAGCCGGCGCTGTGGGCGGTGATGGTGTCGCTGGCCGCGGTC
TGGCAATCGGCCGGGGTTTCACCGTCCGCGGTGGTGGGTCATTCGCAGGGCGAGATCGCG
GCGGCGTGTGTGGCGGGTGCGTTGTCGTTGTCCGATGGTGCCCGGGTGGTGGCGTTGCGG
AGCAGGGCGATCGCGGAGCATCTGACCGGTGGCGGCATGATGGCGTTGTCGGTGCCGGCC
GCGGCGGCGCGGGACTTGATCGCGGACCGGCCCGGGGTGTCGCTGGCCGCGATCAACGGC
CCGTCATCCGTGGTGGTCTCGGGCGAGGCCGACGCCCTGGACTCGCTGCAAGCGCACTGC
GAGGAGCAAGGCGTCAGGGCACGACGGATCGCGGTGGACTACGCCTCGCATTCGGTGCTG
GTGGAACAGATCCGGGACCGGTTGCTGACGGACCTGGCTGCCATCACCCCGCAGACGTCG
AAGGTGCCGGTCGTCTCGTCGGTGACCGGCGAGTCGATGGACACCGTGGGCTGGGACGCC
GAGTACTGGTTCCGGAACCTGCGGAACACGGTGCTGTTCGAACAGGCACTGACGGCGGCC
GGGCCCGGCGTGATCATCGAAGTCAGCCCGCATCCGGTCCTGCTCCCCGCAGTGCAGGAC
ATCGCCCCGGCGGTCGGGACGCTGCGACGCGGCGAGGGCGATCTGCGGCGGCTGCTGGAA
TCGGTTGCCCAGGCACACGCGTACGGCGTGAGCGTCGACTGGAAGCGCCTGGTCACCGGG
CGCCGGGTTCCCCTCCCGACCTACGCCTTCCAGCATCAGCGCTTCTGGCCCGAGCCGGCC
GCCGGTCCCGCCGACGTCAGCGCGGCCGGCCTCAGCGCCGCGGAGCACCCGCTGCTGGGT
GCGATGTTGCCGCTGCCGGAGACCGGCGGTGTGGTGTTCACCAGCCGCCTGTCGCTGCGG
ACCCAGCCGTGGCTGGCCGACTACGCGATCCGGGGCGCCGTGGTGTTCCCCGGTACGGGC
TACGTCGAGCTGGCCGTCCGCGCCGGCGACAGCGTGCAGTGCGACCGGGTCGACGAGCTG
GTCCTCGAGGCGCCGCTGGTGCTGCCCGCCCAGGGGGGCGTACAACTGCAGGTCGTCGTC
GGCGAGGCCGCGGCGGGCAGGCGCAGCGTCGCCGTGTACGCCCGGCCGGACGGACAGGAC
GAATGGACCCGCCATGCCACCGGCGTGCTCAGCGCGAGCGCGGGCCCGGCCGGGCCGGAG
TTCACCGCGGTGGGCCAGGCGTGGCCCGGCCCCGGCGCCACCGAGCTGGACACCCGTGAG
TTCTACGCCGAGCTGGGTACGGGCGGGTTCGCGTACGGGCCGCTGTTCCAGGGTCTGACC
CGGGCCTGGCGGGACGGCGACCGGATCCTCGCCGAGGTCGAGCTGCCCGAGGCGGGACGG
GGCCTGGCCGAGTCGTTCGGGATCCATCCCGCGCTGCTGGACGCGGCGCTGCAGTCCACG
GCGCTGACCGGGCTGGCGGGGCTGCAGTTCAGCTTCGTCGACGTGGTGCTGCGGGCGACC
GGCGCGTCCCGGGTGCGGGTGGCGCTGACGCGGACCGGGCCGGACCAGGTGGCCATCGCG
ATCGCTGACAACAGCGGGCTGCCGGTGTTGTCGATCGGCTCGCTGACCGTACGCCCGCTG
GCGGCCGACAGCATCGTCGCCGGCGTGGGCGACGGCACCCTGCTGAGCCTGCAGTGGGTC
GGCATCCCCGCCGGAACCGCCGATGCCCGTGCAGCCGTGGTGGTGCCGGTTTCCGGTGAT
TCCGGCGCTGTGCTCACGTCCGCGCACGAGCTGACCGCCCGGGTGGTACGGAAGCTGGAC
GAGACCACGGGTCCGCTGGTCGTGGTCACCCGGGGCGCGGTGGCCGTCGAGCCCGGCGAG
CCGGTGACGGACCTGGCCGCTGCGGCGGTGTGGGGCGTGGTTCGCGGGATGCAGACGGCG
GACCCGGGCCGGATCGTGCTGCTCGACACCGACACCGAGGTGGACGGTGCGGTGCTGAGT
CAGGTGCTGGGCGCCGACGAGCCGCAACTGGCCTTGCGCGGCGGGGCCTTGCGGGCCGCC
CGGCTGGTCCGGCACAGCTCCTCGACCGAGCCGGAAACGGTTCCCTCCCGCGTCCTCGTC
ACGGGCGGCACGGGAACCCTGGGCGCGGCCGTGGCACGCCATCTCGTGGCTGCCCATGGC
GTACGGGATCTCGTGCTGCTCAGTCGGCGCGGGTCCGACGCGCCGGGCGCCGCGGAGCTC
GCCGCGGAACTGTCCCAGGCGGGCGCCGCGGTCGAGCTGGTGGCCTGTGACCTGACCGAC
CGTCAGTCCCTGGCCGAGATGCTGACCGCGTACCCGGTTGGTGGACTGGTCCACGCCGCC
CGTGTCGACGGACCCGGGCAGATCGACGCCGCCTGGCACCTGCACGACCTCACACGCGCC
TTCGACCTGTCGCTGTTCGTGGTCTTCTCGTCCCTGGCGGGGATCGTGGGTGACGAGAAC
CGCCCGGGCGACGCCTTCCTCGCCGCCCTGATGCACCAGCGGCACCACGACGGGCTGCCG
GGCCTCGCGCTGGCGTGGGGAGACTGGGAGACCGACCGCGGCCTGTCCGCGCCGCAAGCC
ATGGTCCTGTTCGACCGGGCGCTGAGCGCCGGCGTCCCCGCGGTGGCCCCGACCCGGCTG
AACGTCCAGGCGCTGCGCTCTCAGGCGAACCTTCCGGCCGTGTGGCGCGCGCTGGCCGGG
GGATCGTCGCGCCGTGCCGCCACCCAGGCCCACGGCGGTCGCGACGGTCTTGGCCAGCGG
TTCGCCGGCCTGTCCGCCGCCGAGCGGCAGCAGGCCCTGATCGACCTGGTACGGGAGTCC
GCCGCGGCGGTGCTCGGCTACGGCTCCGCGGCGCAACTGGCCGACGACCAGCCGTTCAGC
GACCTGGGCTTCGACTCGCTGACTGCCGTCGACCTGCGCAACACGCTGCGCACCCGGACC
GGGCTCAACATGCCCGCCACCCTCGTCTTCGACTACCCGACCGTGGCCCGCGTGGCCGGC
TATCTGGCGGAGGAGCTCGGCGAGGTGTCCCCGGCCGCCGCCTCCGCCCTGGTCCCGGCC
GCGCCGCTGCCCGTTGCGGTCGCTGACGATCCGGTCGTGCTGGTCGGCATGGCGTGTCGT
TATCCGGGTGGTGTCACGGGTCCGGACGAGTTGTGGGACCTGGTGGCGGCCGGGGCGGAC
GGGATCACGCCGTTCCCCGCTGACCGCGGCTGGGATCTTGACGCGCTCCTTGGCGTCGAC
GGGTCCGCGGCGTCGGCCACGGCCGAGGGCGGCTTCCTCGCCGGCGCCGGCGAGTTCGAC
GCCGCCTTCTTCCGCATCTCGCCGCGCGAGGCCCAGGCGACCGACCCGCAGCAGCGGTTG
CTGCTGGAGGTGTCGTGGGAGGCGTTGGAGCAGGCGGGTATCGATCCTCTGTCCCTGGCA
GGCAGTTCGACCGGTGTCTTCGCGGGCGTCTACTCCTCCGGGTACGCCGATCTTGTCGCC
CGTGGTGGGGAGCAGTTGCAGGGTCACCAGATCACGGGTGGCGCGGCCAGCGTGATCTCC
GGGCGGGTTGCGTACACGCTGGGGCTGGAGGGTCCCGCGGTGAGCGTGGACACGGCGTGT
TCGTCGTCGCTGGTGGCGATGCATCTGGCCGCGCAGGCGCTGCGGGCGGGGGAGTGCTCG
CTGGCGCTGGCCGGCGGCGTCACCGTCATGGCGACGCCCGACGCGTTCGTCTGGTTCACC
GTGCAGGGTGGTCTGTCCCCGGACGGCCGGTGCCGGTCGTTCGCCGACAGCGCTGACGGG
ACGGGTTGGTCCGAGGGCGTCGGTGTGGTGGTGATGGAGCGGCTGTCCGACGCTGTGCGC
AACGGCCACGAGGTTCTCGCGGTCATGCGGTCGAGTGCGGTGAACCAGGACGGTGCGTCG
AATGGTCTGACGGCTCCGAACGGTCCCTCTCAGCAGCGGGTGATCCGTCAGGCGCTGGCG
GCGGCGGGTCTGTCGTCGGCTGACGTGGATGCGGTGGAAGCCCATGGGACGGGCACCAGG
CTCGGTGATCCGATCGAGGCGCAGGCGTTGCTGGCCACGTATGGCCAGGACCGTCCCGGC
GACCGGCCGTTGTGGCTGGGGTCGTTGAAGTCGAACATCGGCCATGCGCAGGCTGCCGCG
GGTGTCGGTGGTGTGATCAAGATGGTCATGGCGCTGCGTCATGGGGTCCTGCCCAGGACT
CTGCATGTCGATGAGCCGTCGACTCAGGTCGACTGGACGCAGGGTGATGTGCGGCTGCTG
ACCGATGCGGTGCCGTGGCCGGAGACCGGTCGTCCGCGCCGGGCCGGGGTGTCCTCGTTC
GGTGTCAGTGGTACCAACGCGCATGTCATCCTCGAAGCCCCCGAGGCAACCGGGCCCGAG
CCCGGGCCTGAGCCCGGGCCTGAGCCCGGGGTTGGCGGCCTGGTTCCGTGGGTGTTGTCC
GGCAAGACGGCTGATGCGGTGCGTGCCCAGGCGGCGAGGCTGCTGGAACGTGTCGGGTCG
GATCCGTCGTTGCGGCCGTTGGATGTGGGCTGGTCGTTGGTGGATACGCGTGCGGTGTTC
GACCATCGTGCGGTGGTCGTGGGCGGTGACCGCGAACAGCTCCTCGCCGGTCTGCGCAAT
GTGTCCCCGGCCGTTGCCCAGACGGCCCCCCGGCTGGGTGTGTTGTTCACCGGTCAGGGT
GCGCAGCGGGTGGGTATGGCCCGGGGTTTGTATGAGAGGTCGCCGGTGTTCGCGGCGGCG
TTGGATGAGATTGTCGCGGAGTTGGATCCCCTGCTGGAGCGTTCTTTGTTCGGGGTGATG
TGGGGTGATGATCCGGGTCTGGTGGATCGGACGGGGTGGGCGCAGCCGGCGCTTTTCGCG
GTGGAGGCGGCGCTGTTCGCGGTGCTGCGTTCGTATGGGGTGCGTCCGGCTTTTCTGCTG
GGTCATTCCATTGGTGAGGTGACGGCTGCGTATGTGGCGGGGGTGTGGTCGCTTCCTGAT
GCGTGTCGGGTGGTGGCGGCGCGGGCGAGGCTGATGCAGGCGTTGCCGGCTGGTGGGGCG
ATGGCCACGGTTCAGTTGCCCGAGGCGGATGTCGTTCCGTTGTTGCCTGAGGGGGTGGCG
GTCGCCGCGGTCAACACGGCGGGTTCGGTGGTGGTGTCGGGTCCGCGGGATGCGGTGGAA
CGGCTGCTGGCGTCGGTTTCGGTGAAGGTGACGCGGTTGAGGGTGTCGCATGCGTTCCAC
TCGGCGTTGATGGATCCGATGCTGGCGGAGTTTGCGCGGGTGTTGGAGTCGGTGGAGTTC
CGGGAGCCGCGGATTCCGGTGGTGTCGAACTTGACCGGTGTGGTGGGTGACGAGTTGACG
TCGCCTGGTTATTGGGTGCGGCAGGTGCGGGGCACGGTCCGGTTCGCCGATGGGGTGCGG
TGGCTGGGTGAGCAGGGTGTGAGCGTGTTGGTGGAGGCTGGTCCGGACGGGGTGTTGTCG
GGGCTGGTGGACAACAGTGCACCGATGCTGCGGCGCAAGCGTGACGACAGCGAGGCGGTG
CTGGCCGCGATCGGGCATCTCTGGGCGAACGGCGTCACCGTGGACTGGGCGCCGGCTTTC
GAGGGCCTGCACGCGCGGCGGGTCAAGCTGCCGACCTACGCGTTCCAGCACCAGCGCTTC
TGGCCGGAACCGGTGCATCAGCCGACGGACGTGACCGCCGCGGGCCTGAGCGCCGCCGGC
CACCCGCTGTTGGGCGCCATGCTGCCGCTGCCCCGTACGAACGGCGCGGTCTTCACCAGC
CGCCTGTCCCTGCGCACCCATCCGTGGCTGGCCGAGCACACGGTTGACGGCGCTGCGGTG
TTCCCGGGCTCCGGTTACGTGGAACTCGCCGTCCGGGCCGGTGACGGCGTGGGCTGCGGC
CACCTCGACGAGCTCGTCCTCGAGGAGCCGTTGGTGCTGCCCGCTCAGGGCGGCGTCCAG
CTCCAGGTAGTGGTCGGCGACGACCCCGCCGAGGCGGGCACCTCGCGCCGCAGCGTCACC
GTCTACGCCCGCCGGGACGACGCCGAGTCCTGGACCAGGCACGCCACCGGAGCGGTGACA
GCCACCCCGGCACAGGCAACCCCGGCGCAGGCCGGCCCGGAGCTCGACCTGGTCACCGGG
GCGTGGCCCGGGCCGGGCGCGACAGAGTTGGACCTCGCCGGCTTCTACGACAGCGTCGAG
TACGGCCCGCTGTTCCAGGGGGTGACCAAGGCCTGGCGGCGCGCCGGCCATGTCATCGCC
GAGGTTGCTGTGCCCGCCGAGGCCGGTGCGGAGTCGTACGGCATCCATCCGGCCCTGCTC
GACGCGGTGCTGGGGACCGCAAAGCTCACCGGAGTCGACGGGTCGCCGTTCGGGCTCACC
GGCGTGGTCCTGCACGCGGCCGGTGCCGCCCACCTGCGGGTGGCCCTGACCCGCACGGAC
GATGCGGCGGTCTCCATCGCGGCGGCGGACGGTGCCGGGCAGCCGGTGCTCTCGATCGGC
TCGCTGAGCCTCCGGCACCTGGACACCATCAACATCACGGCTGTCCGCGGCGACCGGTCC
CTGCTACGGCTGGACTGGATCGACATCGCCGCGACCGGCAGCCCGGTCACCAAGTGGGTG
ACGGCCGACAGCACGGACCAGGAGTCGGCGCAGGTTGCCGTGTTGTCCGCCTCCGCCGCC
CCGGACGACGTCGCCGCGTCCACGCACGAGCTCGTCGGCCGCGTCCTGGAGCAACTGCAG
TCCTGGCTGACGGAGGCCACGATCCCGCTGGTTGTCCTGACCCGCGGCGCGGTTGCCGCC
GATCCCGGCGAGCCGGTCACCGATCTGGCCGCCGCGGCGGTGTGGGGCCTGGTGCGCTCG
GCACAGACCGAGAACCCGGGCCGCATCGTCCTGCTCGACATGGACGCTGACACGAACGCG
AACGCAGACACGGGCAGGGACATGGGCGTCGACGCCGCGCTGCTCGGTCACGTCCTGGCG
AGTGGGGAGCCCCAGCTGGCCCTGCGCAACGGGACACTACGCGCCGCGCGACTGACAAGG
ATCGAGCCCACGGACCAGCCGCCGACGCCCCTGGAGCACGCCGGAACCGTTCTCATCACG
GGCGGCACTGGCGGACTGGGCGGCGTGGTGGCCCGGCACCTGGTCGGCGAGCACGGTGTG
CGGAGCCTGTTGCTGCTCAGCCGGCGAGGAATGGCGGCAGCGGGTGCGGAGGAGCTGGTC
GCGGAGCTGTCCGGCACAGGTGCCGCCGTCGAGGTCGTGGCCTGTGACGTCACCGATCGG
GTGGCGCTGGCCGAGGTCATCGGCGCCCACGACATCAGCGGAATCGTGCACACCGCGGGT
GTGGTCGAGGACGGCGTCGTCGCCACGCTCTCGCGGGAACAACTGGACCGGGTGCTCGCA
CCGAAGGTCGATGCGGCCTGGCACCTGCACGAGCTGACCCGCGGCCTCGACCTGTCGATG
TTTGTCCTGTTCTCGTCGATCGGCGGGCTGCTCGGCGGCGGCGGGCAGGCCAACTACGCC
GCCGGCAACGCCTTCCTCGACGCGCTCGTGCAGCAACGGCGCCACGACGGTCTGCCCGGC
GTGTCGATGGCCTGGGGGCCGTGGACGACCGAGGTCGGCATGGTCGGCACGCTGTCGGAG
ACCAACCGGCGGCGGATGGGCCGGGCGGCGCTGCCTGCGCTCGCCGTCGAACACGGCCTG
GAGCTGTTCGACGAGGCGCTGCGGGCCGACCTCCCGCTGCTGGCGCCGACACGGCTCGAT
CTGCGGGCGTTGCGGGCGCAGCCGGAGATTCCCGCCCTGTGGCGGGCTCTGGCCGGCGGC
CCTGCCCGGCGTACCGCCGGCGCCGCGCCCGACGGCAGCGTCGGTCAGGGCTTGGCCGCT
CTGCCGCCGGCCGAGCGGGAGAAGGCCCTCGTCGAGCTGGTCAGCGAGTCGGCCGCGGTG
GTGCTGGGGCATGCCTCGGCCGCGCAGATCAACGCCCAGCAGCCGTTCAGCGAGCTGGGT
TTCGACTCGCTGACCTCGGTGGAGCTGCGCAACCTGCTGCAATCCCGTACCGAGCTCAGC
CTCGCCGCGAGCGCGGTGTTCGACTATCCGACCGTCACCCGGCTGGCTGCGCACCTGGCC
GGCGAGATCGGCGAGCCGGACGCTGCCGGGCCGGCGTCGGTGCCGGCGGTCGGCACGGTC
ACCGACGACCCGATCGTGCTGGTCGGCATGGCCTGCCGCTTCCCGGGCGATGTCCAGGGC
CCGGAAGACCTGTGGCGCCTGATCAGCGAGGGAACCGACGGCATCGGCTCCTTCCCGACC
GACCGTGGCTGGGACCTCGACGCGCTGCTCGGTCCGGACGGCTCCGGCACCGGCACGTCG
ATCACCGCGGAGGGTGGTTTCCTCACCGGCATCGACGAGTTCGACGCGGCGTTCTTCCAC
ATCTCGCCACGCGAGGCCCAGGCGACCGATCCACAGCAGCGGTTGCTGCTGGAAGTGGCC
TGGGAGGCCCTGGAACGTACGGGCATCACCCCCTCGGCCCTGGCGGGCAGCGCCACGGGC
GTCTTCGTCGGCGCCTACCAGACCGGCTATCTCGACCTGGTCAACCGCGGCCATGACGAC
CTGCGCGGACATGTGCTCACCGGCGCGGCGACCAGCGTGATGTCCGGTCGTGTGGCGTAC
GCCCTGGGGCTGGAAGGTCCAGCGGTCAGCGTGGACACCGCCTGCTCGTCGTCCCTGGTG
GCCATGCACCTCGCGGCCCAGGCCCTGCGGTCGGGTGAGTGCTCGCTCGCCCTGGCCGGC
GGTGTGACGGTGATGGCGACGTCCGACATGTTCGTCGGGCTCACGAAGCAGGGCGGCCTC
TCCGCGGACGGCCGGTGCAGGTCCTTCGACGACGCCGCCGACGGGACGGGCTGGTCCGAG
GGCGTCGGCGTCGTGGTGATGGAGCGCCTTTCCGAGGCTCGGCGCAACGGCCACGAGGTC
CTCGCCGTGTTCCGCGCCAGCGCGGTCAACCAGGACGGCGCCTCCAACGGGCTGACGGCT
CCGAACGGCCCCTCCCAACAGCGCGTGATCCGTCAGGCCTTGGCGACCGCGGGTCTGTCA
CCCGCCGACGTGGATGCGGTCGAGGCCCACGGTACGGGCACCAGGCTCGGTGACCCGATC
GAAGCCCAGGCCCTGCTGGCGACCTACGGCGGCGACCGCCCCGGCGACAAGCCCCTGTGG
CTCGGCTCCTTGAAGTCCAACATCGGCCACACGCAGGCGGCCGCGGGTGTCGGTGGCGTG
ATCAAGATGGTCATGGCTCTGCGTCACGGCATCCTGCCCAAGACCCTGCACGTGACCGAG
CCGTCGACGAAGGTCGACTGGACTCAGGGCGACGTCCGGCTGCTCACCGAGGCCGTGCCG
TGGCCGGAGACGGGCCGTCCCCGCCGGGCCGGGGTGTCCGCTTTCGGCATCAGCGGCACC
AACGCACACATCATCCTGGAAGCGCCGGAACCGGATCCCGCCGGTGCCGGGCCCGAGACG
ATGCCCGATGTGACCCCCGTCGTGCCGTGGGTGGTGTCCGGCAAGACTGCCGCGGCGGTC
CGAGCCCAGGCCGCGCGGCTGCTCGAACACGTGGAATCGGTTCCCGGGCTTCGTCCGGTG
GACGTGGGCTGGTCGCTGCTGGCCAGCCGGGAGACCTTCGAGTACCGGGCGGCCGTGGTG
TCCGGCGACCGGGACGAGCTGCTGGCCGGCCTGCGCGCCATCAGCGACGACGCCGTGCAA
CCGGCTCCCGCCCGTTTTCCGGACCGGGTCGTGTTCGTGTTCCCGGGTCAGGGTGCGCAG
TGGGTGGGGATGGCTCAGGAGCTGCTCGGGTCTTCGCCTGTCTTCGCCTCGTCGATGGGT
GAGTGTGCGGAGGCTCTGGAGCCGTTCGTGGACTGGTCGCTGGTCGATGTGCTGGGTGAC
GAGTCGGCGTTGCGGCGGGTGGATGTCGTGCAGCCGGCGTTGTGGGCGGTGATGGTGTCG
CTGGCCGCGGTCTGGCGTTCGTACGGGGTGGAACCGGCTGCGGTGGTGGGTCATTCGCAG
GGCGAGATCGCGGCGGCGTGTGTGGCGGGTGCGTTGTCGTTGTCCGATGGTGCCCGGGTG
GTGGCGTTGCGGAGCAGGGCGATCGCGGAGCGTCTGACCGGTGGCGGCATGATGGCGTTG
TCGGTGCCGGCCGCGGCGGCGCGGGACTTGATCGCGGACCGGCCGGGGCTGTCCTTGGCG
GTCGTCAACGGTCCGGGGGCCACGGTGGTCTCGGGTGAGGCTGCGGCGCTTGACCGGTTG
CAGGCGTACTGCGACGAGCACGGGATCCAGGCGCGGCGGATTGCCGTGGACTATGCCTCG
CATTCGGTGCTGGTGGAACAGATCCGGGACCGGTTGCTGACCGACCTGGCTGCCATCACC
CCGCAGACGTCGAAGGTGCCGGTCGTCTCGTCGGTGACCGGCGAGCTGATGGACACCGTG
GGCTGGGACGCCGAGTACTGGTTCCGGAACCTGCGGAACACGGTCCTGTTCGAACAGGCA
CTGACGGCGGCCGAGCCCGGCGTGGTCATCGAGATCAGCCCGCACCCGGTGTTGCTGCCC
GTCATCCAGGACACCGTCCCGGTGGTCGGAACGCTTCGGCGCGGTGAGGGCGGCCTGCAG
AGGCTGGTGACATCGGTCGCGCAGGCACACGCGCACGGCGTCAGCGTGGACTGGACGACC
CTGTTCGCCGGCCACGGCGCGAGGCGGGTCCCCCTGCCCACGTACGCGTTCCAGCGCGGC
CGCTTCTGGCCCGAGCCGGCCGGCGGCCCCGCCGACTTCGCCGCCGCGGGCATGAGCTCG
GCGGAGCACCCGTTGCTCGGGGCCATGGTGCCGTTGCCGCACAGCGACGGAGTGCTGTTC
ACCAGCCGACTGTCGCTCCGCACCCACCCGTGGCTCGCCGACCACGCCGTACGGGGAACC
GTGATATTCCCCGGCACGGGCTATGTCGAGCTGGCCGCCCGCGCCGGCGACAGCGTCGGC
TGCGCCAAGCTGGACGAACTCGTTCTGGAAGCACCGCTGGTGCTGCCCGCCCAGGGCGGC
GTCCAGGTGCAGGTCGTGGTGGACGCGGGCGAGACGCAGCGGGCCGTGTCGGTGTACGCC
CGGCCGGAAGGCCAAGAGGAGTGGACTCGGCACGCCACCGGCCTGCTGAGCGCCGACGCC
CCCGAGACGGGGGACGAGTTCGACGCCGTACGCGGAAACTGGCCGGCGCCCGGAGGCACG
GAGCTGGACACGGCCGGCTTCTACGAGCAGCTCACCGCGGCCGGCTTCCTCGTCTACGGC
CCGATCTTCCAGGGCCTGACCCGTGCCTGGCGGCACGGCGACCGGATCCTCGCCGAGGTC
GAGGTGCCCGCCGCGGCCGGACCCGAGTCGTACGGGCTCCATCCGGCACTGCTGGACGCC
GCGCTGCACGCCACGGTGTTCGCCGAGCTCGACGCGGCCCGTACGGGCGGCCTCCCCTTC
AGCTTCACCGACGTGATCCTGCGGGCCACCGGCGCCTCGCGGCTGCGGGTGGCATTGACG
CGCACGGGCCCTGACGAGGTGGCGATCGCGGTCGCCGACGGCACAGGGCTGCCGGTGCTG
TCGATCGGCTCCCTCGTCGTGCGCCCGGCGGCCGCAGCCGGTCCCGTCGTGGGCGTCGGC
GACGGCGTCCTCGTGACGATGTCCTGGACCGACACCACCGCCACGGGTGCTCCCGTGGGG
GACTGGCTGCTCGTCGACCGGAACGGCACCGGTCACACCACTGTGGAGACCCTCGACACA
GTTGACTCGTCGCCGGTCGTACTCGCCGTGGCGGCCGGGCCCGGTCCCGTCGTCGACACC
ACGCACGAACTGACCGGCTGGGTTCTGGAACAACTGCAGCACTGGCTGCGTAAGGAATCC
GTCGCTCCGCTGGTCGTGTGGACGCGCGGGGCGGTCGCGGCGCACCCCGGCGAGTCCGTG
GGCGACCTGCCCGCCGCGGCGGCGTGGGGTCTGGTGCGCTCGGCGCAGAGTGAGAACCCG
GGCCGGATCGTCCTGCTCGACACCGACGCCGCCCTCGACGCGGCCGTGCTGGGCCGGGCC
CTGGCCACGGACGAGCCCCAGCTGGCTCTGCGCGGCGGGCAGTTCCAGGCCGCCCGCCTG
ACCCGGGTCGTACCCGCCGACGAATTGGCCGTCCCCGGCCCGGACACGCCGTGGCGGCTC
GGCCTGACCGAGAGCGGGACGCTGGACGGCCTGGCCCTGTTGCCCTGCCCCGAGGCGACC
CGGCCGCTGGCCCCGCACGAGGTGCGCCTGGAGGTACGCGCGGCCGGCCTCAACTTCCGG
GACGTGCTCAACGCCCTGGGCATGTACCCGGGCGAGCCCGGCCCGCTCGGCAGCGAGGCG
GCAGGCGTGATCGTCGAGGTCGGCTCCGGCGTGACCGGCCTGGCGGTCGGCGATCGGGTG
ATGGGCCTGGCCTTCGGCGCGTTCGGCCCGCTCGTGGTGACCGACCACCGGCTGCTCGTG
GCCATGCCGGCGGGCTGGCAGTTCAGCACCGCCGCTTCGGTCCCGATCGTGTTCCTCACC
GCCTGGTACGGCCTCGTCGACCTCGCCGGCCTACAGGCGGGCGAGTCGGTGCTGGTGCAC
GCCGGCAGCGGCGGCGTGGGGCTCGCCGCCGTCCAGATCGCGCGACACCTCGGCGCCGAG
ATCTTCTCGACCGCGAGCCCGGCCAAGTGGCCGGTGCTGCACGAGTGGGGCGTCGCGGAG
GACCACGTGGCCTCGTCCCGCGACCTGGACTTCCACCGGCGCTTCACCGAGGGCACCGGC
GGCCGCGGCGTCGATGTCGTACTCAACGCCCTGGCCGGCGAGTTCGTGGACGCCTCGCTG
GATACGCTGGCCCCCGACGGGCGGTTCGTGGAGATGGGCAAGACCGACGTCCGCTCGTCC
GAGCAGCTGCGGGACCGTCACCCCGGGGTGTGCTATCAGGCCTTCGAGCTCATGGACGCC
GGGGCCGTCCGGGTCCAGGCGATGCTGCGGGAGCTGGTCGAGCTATTCGAAGCGGGCGAT
CTGCGACCGCTTCCGGTGGCCGACTGGGACATACGTCAGGCGCCGGCCGCGTTCCGGTAC
ATGAGTCAGGCCAAGCACATCGGCAAGCTCGTGCTGACCGTTCCGGCCGCGACACGGCTC
CCCGTCGACAACGACGGCACGGTTGTGATCACCGGCTCCGGCGGTCTGGGCGGGCTGGCC
GCACGCCATCTGGTTCGCGAGTACGGCGTCCGGCACCTGTTGCTGGTCAGCCGCCGTGGC
GCGGAGGCCCCCGGTGTGCCGGAGCTGGTGGCCGAGCTCGCCGACGAGGGGGCCACGGCC
CTGGTCGCCGCCTGTGACCTGAGCGATCGGCAGGCTCTGGCCGGAGTTCTCGCGTCCGTG
CCGCCGGACCACCCGGTGACCGGCGTGGTGCACACCGCCGCGGTCCTGGAGGACGGCGTC
ATCGGCTCGCTCACACGAGAGAAGCTCGACCGGGCGCTCGCTCCCAAGGTGGACGCGGTG
TGGCACCTGCACGAGCTGACCCGCGACCTCGACCTGTCGATGTTCCTCGTGTACTCGTCG
CTCGCCGGGCATCTGGGCAGCGCGGGGCAGGGCAACTACGCCGCCGCCAACGTGTTCCTG
GACGCGCTGATGCGCCGACGCCGCCGGGACGGCCTGCCCGGCCTGTCGCTGGCGTGGGGC
GCGTGGACGACGGAGGTCGGCCGGGTCGGCGAGCTGTCTCGCGGCGACCTGGAACGCATC
ACCCGCTCGGCCATGCCGCTGCTCGGCGTCGAGCAGGGCATGGAGCTGTTCGACCGCGCG
CTGCGTACCGGTCATGCGGTCCTCGGCCCGGCCCGACTCAATCCGCAGGCCCTGCGGGCG
CAGCCGGACGTCGCACCGCTGTGGCGCAACCTCGCTGGTGGTGCGCCCCGCCTCCCCGCG
GCCGACAACACCCGCAACGGGCACGAGGACCTCGAACAGCGGCTCGCCGGCTTGTCCCGG
GCCGACCGCGAGAAGATCCTCACCGACCTGGTACGGGGCTCGGCCGCGACCGTGCTGGGG
CACTCCTCCGCGGGCCGGATCGACACCGACCGGTCCTTCAGCGAGCTCGGCTTCGACTCG
CTGACCTCGGTCGAGCTGCGCAACCTGCTCAGGACCCGGACGGGCCGGACACTGTCGTCC
GGCGTGGTGTTCGACTATCCGACCGTCACCCAGCTGGCCGGCTACGTCGACTCCCTCTTC
GCCCCCGCCGAGCCGTCCGGCGACGAGGACGGGCCGGACGGTGCCGTCGCCCGCCGGGCT
CGGCCGGCCGACGACGGTCCCGACGAGGCTCTTCTGCTCGACGCCGACGTCGACGACCTC
ATCAACATCGCGCTTCGCGATCAGTGA
[0] KSQ125..492
[0] AT646..917
[0] malonyl-CoA828..832
[0] ACP992..1066
[1] KS1083..1450
[1] AT1621..1926
[1] methylmalonyl-CoA1808..1812
[1] dh1973..2120
[1] KR2391..2567
[1] ACP2668..2738
[2] KS2757..3133
[2] AT3296..3563
[2] malonyl-CoA3478..3482
[2] KR3882..4062
[2] ACP4164..4234
[3] KS4257..4634
[3] AT4787..5091
[3] methylmalonyl-CoA4974..4978
[3] dh5136..5299
[3] kr5556..5712
[3] ACP5793..5863
[4] KS5890..6264
[4] AT6415..6682
[4] malonyl-CoA6597..6601
[4] dh6761..6928
[4] KR7215..7391
[4] ACP7486..7560
[5] KS7583..7958
[5] AT8111..8415
[5] methylmalonyl-CoA8298..8302
[5] DH8463..8626
[5] ER8926..9232
[5] KR9246..9425
[5] ACP9527..9597
[0] KSQ373..1476
[0] AT1936..2751
[0] malonyl-CoA2482..2496
[0] ACP2974..3198
[1] KS3247..4350
[1] AT4861..5778
[1] methylmalonyl-CoA5422..5436
[1] dh5917..6360
[1] KR7171..7701
[1] ACP8002..8214
[2] KS8269..9399
[2] AT9886..10689
[2] malonyl-CoA10432..10446
[2] KR11644..12186
[2] ACP12490..12702
[3] KS12769..13902
[3] AT14359..15273
[3] methylmalonyl-CoA14920..14934
[3] dh15406..15897
[3] kr16666..17136
[3] ACP17377..17589
[4] KS17668..18792
[4] AT19243..20046
[4] malonyl-CoA19789..19803
[4] dh20281..20784
[4] KR21643..22173
[4] ACP22456..22680
[5] KS22747..23874
[5] AT24331..25245
[5] methylmalonyl-CoA24892..24906
[5] DH25387..25878
[5] ER26776..27696
[5] KR27736..28275
[5] ACP28579..28791

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [636-766]  G3DSA:3.40.366.10 [828-934]  G3DSA:3.40.366.10 [1618-1741]  G3DSA:3.40.366.10 [1808-1914]  G3DSA:3.40.366.10 [3286-3416]  G3DSA:3.40.366.10 [3478-3583]  G3DSA:3.40.366.10 [4781-4907]  G3DSA:3.40.366.10 [4974-5081]  G3DSA:3.40.366.10 [6404-6535]  G3DSA:3.40.366.10 [6597-6702]  G3DSA:3.40.366.10 [8108-8231]  G3DSA:3.40.366.10 [8298-8404]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [5558-5699]  4.6e-27 PF00106
PF00106   adh_short
IPR002364 Quinone oxidoreductase/zeta-crystallin, conserved site (Conserved_site)
 [9054-9075]  PS01162
PS01162   QOR_ZETA_CRYSTAL
IPR006162 Phosphopantetheine attachment site (PTM)
 [1024-1039]  PS00012 [2696-2711]  PS00012 [5821-5836]  PS00012 [7518-7533]  PS00012 [9555-9570]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [992-1066]  PS50075 [2668-2738]  PS50075 [4164-4234]  PS50075 [5793-5863]  PS50075 [7486-7560]  PS50075 [9527-9597]  PS50075
PS50075   ACP_DOMAIN
 [999-1065]  5.8e-11 PF00550 [2674-2737]  8.5e-10 PF00550 [4167-4233]  1.5e-10 PF00550 [5796-5862]  2.5e-12 PF00550 [7494-7559]  4.9e-10 PF00550 [9530-9596]  2.5e-10 PF00550
PF00550   PP-binding
 [989-1099]  7.60000011115812e-25 SSF47336 [2661-2773]  1.29999924468179e-24 SSF47336 [4157-4273]  2.19999900980708e-27 SSF47336 [5786-5906]  4.90001027782405e-28 SSF47336 [7483-7599]  1.60000240695997e-26 SSF47336 [9518-9604]  5.29999657550189e-20 SSF47336
SSF47336   ACP_like
 [995-1068]  4.09999999999995e-125 G3DSA:1.10.1200.10 [2668-2742]  4.09999999999995e-125 G3DSA:1.10.1200.10 [4162-4238]  4.09999999999995e-125 G3DSA:1.10.1200.10 [5790-5867]  4.09999999999995e-125 G3DSA:1.10.1200.10 [7488-7564]  4.09999999999995e-125 G3DSA:1.10.1200.10 [9527-9599]  4.09999999999995e-125 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
IPR011032 GroES-like (Domain)
 [8914-9061]  9.69997533354407e-34 SSF50129
SSF50129   GroES_like
IPR013149 Alcohol dehydrogenase, C-terminal (Domain)
 [9065-9156]  9.8e-18 PF00107
PF00107   ADH_zinc_N
IPR013154 Alcohol dehydrogenase GroES-like (Domain)
 [8945-9002]  5.60000000000001e-08 PF08240
PF08240   ADH_N
IPR013968 Polyketide synthase, KR (Domain)
 [2391-2566]  5.19999999999996e-61 PF08659 [3882-4061]  9.9e-62 PF08659 [7215-7389]  4.6e-59 PF08659 [9246-9423]  2.50000000000001e-56 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [125-367]  2.39999999999997e-76 PF00109 [1083-1324]  2.50000000000001e-84 PF00109 [2757-3007]  2.50000000000001e-89 PF00109 [4257-4508]  1e-87 PF00109 [5890-6138]  9.9e-87 PF00109 [7583-7833]  1.69999999999998e-88 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [375-492]  6.80000000000006e-39 PF02801 [1332-1450]  1.5e-46 PF02801 [3015-3133]  4.6e-46 PF02801 [4516-4634]  5.00000000000001e-47 PF02801 [6146-6264]  1.5e-46 PF02801 [7841-7958]  8.20000000000006e-47 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [646-917]  1.09999999999999e-53 PF00698 [1621-1926]  2.50000000000001e-94 PF00698 [3296-3563]  3.99999999999998e-54 PF00698 [4787-5091]  3.79999999999991e-96 PF00698 [6415-6682]  4.39999999999997e-54 PF00698 [8111-8415]  1.10000000000001e-95 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [641-943]  5.6999970878395e-69 SSF52151 [1619-1903]  2.1000026783403e-63 SSF52151 [3291-3593]  3.89999861795218e-69 SSF52151 [4785-5080]  2.69998997787809e-64 SSF52151 [6410-6712]  2.89997807423186e-69 SSF52151 [8109-8393]  4.19999771339582e-63 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [768-827]  1.89999859865864e-11 SSF55048 [1743-1807]  2.2999993566538e-15 SSF55048 [3418-3477]  5.90000104995095e-12 SSF55048 [4909-4973]  1.39999892049878e-17 SSF55048 [6537-6596]  6.899999633797e-12 SSF55048 [8233-8297]  2.2999993566538e-15 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [125-378]  G3DSA:3.40.47.10 [379-546]  G3DSA:3.40.47.10 [1083-1335]  G3DSA:3.40.47.10 [1338-1501]  G3DSA:3.40.47.10 [2756-3017]  G3DSA:3.40.47.10 [3021-3183]  G3DSA:3.40.47.10 [4256-4519]  G3DSA:3.40.47.10 [4522-4684]  G3DSA:3.40.47.10 [5889-6149]  G3DSA:3.40.47.10 [6152-6314]  G3DSA:3.40.47.10 [7582-7843]  G3DSA:3.40.47.10 [7847-8010]  G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [116-489]  6.00001679190159e-83 SSF53901 [1075-1448]  9.30000048475962e-97 SSF53901 [2756-3131]  2.7000136937899e-100 SSF53901 [4249-4686]  8.39998014024973e-96 SSF53901 [5889-6262]  1.3000049540733e-95 SSF53901 [7575-7957]  2.80000504261099e-102 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [2392-2573]  G3DSA:3.40.50.720 [3882-4064]  G3DSA:3.40.50.720 [5557-5719]  2.30000000000004e-116 G3DSA:3.40.50.720 [7216-7397]  G3DSA:3.40.50.720 [9062-9155]  1.99999999999999e-21 G3DSA:3.40.50.720 [9245-9462]  G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [1237-1253]  PS00606 [2920-2936]  PS00606 [4421-4437]  PS00606 [6051-6067]  PS00606 [7746-7762]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [646-925]  2.1000026783403e-112 SM00827 [1623-1906]  3.99998544139406e-112 SM00827 [3296-3575]  1.50000965748778e-113 SM00827 [4789-5072]  8.39998014024973e-117 SM00827 [6415-6694]  1.59998835313644e-113 SM00827 [8113-8396]  1.59998835313644e-111 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [997-1069]  9.00000407957274e-28 SM00823 [2669-2741]  6.59999852526375e-30 SM00823 [4165-4237]  5.20000089003336e-31 SM00823 [5794-5866]  2.60000517657733e-33 SM00823 [7491-7563]  2.60000517657733e-28 SM00823 [9528-9600]  4.19999771339581e-29 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [1973-2120]  8.20001307135067e-47 SM00826 [5136-5299]  2.19999900980707e-77 SM00826 [6761-6928]  1.79999754022378e-69 SM00826 [8463-8626]  1.79999754022378e-74 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [126-547]  SM00825 [1085-1502]  SM00825 [2759-3185]  SM00825 [4259-4686]  SM00825 [5892-6316]  SM00825 [7585-8011]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [2391-2567]  3.29999077503323e-59 SM00822 [3882-4062]  3.70001063537244e-58 SM00822 [5556-5712]  1.79999754022375e-20 SM00822 [7215-7391]  8.5000302480906e-59 SM00822 [9246-9425]  2.1000026783403e-56 SM00822
SM00822   PKS_KR
IPR020843 Polyketide synthase, enoylreductase (Domain)
 [8926-9232]  SM00829
SM00829   PKS_ER
SignalP No significant hit
TMHMM No significant hit