close all open/close all

CDS information : Tatmc_00090


close this sectionLocation

Organism
StrainCK4412
Entry nameTautomycetin
Contig
Start / Stop / Direction38,119 / 60,981 / + [in whole cluster]
38,119 / 60,981 / + [in contig]
Location38119..60981 [in whole cluster]
38119..60981 [in contig]
TypeCDS
Length22,863 bp (7,620 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)tautomycetin biosynthetic PKS
Gene
Gene (GenBank)tmcB
EC number
Keyword
Note
Note (GenBank)
  • polyketide type I; tmcB
Reference
ACC
PmId
[17379718] Isolation of the biosynthetic gene cluster for tautomycetin, a linear polyketide T cell-specific immunomodulator from Streptomyces sp. CK4412. (Microbiology. , 2007)
[20623733] Biochemical and structural characterization of the tautomycetin thioesterase: analysis of a stereoselective polyketide hydrolase. (Angew Chem Int Ed Engl. , 2010)
[27277081] Thioesterase domain swapping of a linear polyketide tautomycetin with a macrocyclic polyketide pikromycin in Streptomyces sp. CK4412. (J Ind Microbiol Biotechnol. , 2016)
Related Reference
ACC
C6ZCS0
PmId
[19191560] Characterization of the tautomycetin biosynthetic gene cluster from Streptomyces griseochromogenes provides new insight into dialkylmaleic anhydride biosynthesis. (J Nat Prod. , 2009)

close this sectionPKS/NRPS Module

6 methylmalonyl-CoA
7 malonyl-CoA
8 ethylmalonyl-CoA
not conserved XAGHS
9 malonyl-CoA
KS78..453
AT625..929
DH977..1143
ER1424..1726
KR1736..1916
ACP2016..2086
KS2109..2483
AT2632..2900
DH2978..3142
ER3447..3750
KR3760..3935
ACP4028..4098
KS4120..4496
AT4646..4960
DH5008..5166
KR5460..5636
ACP5733..5807
KS5830..6205
AT6358..6625
KR6960..7140
ACP7242..7312
TE7387..7600

close this sectionSequence

selected fasta
>polyketide synthase [tautomycetin biosynthetic PKS]
MPSPAGLGRPTTVPTRLFCSTPTSTTSSTSRFAISERPTRELMMAVSVDKLTEALRASLL
ANTRLRQENKTLADAAGEPIAIVGMACRYPGGVAGPDDLWRLVESGGDGVGPFPADRGWD
LDELLGTAESPPASVTSEGGFLADAGDFDAAFFRMSPREALATDPQQRLLLETSWEALEH
AGIDPVALKGSRTGVFAGAYQMGYTGLVTESDEQLRGHAFTGGAGSVTSGRVAYTLGLEG
PAVSVDTACSSSLVAMHLAAQALRAGECTLALAGGVTVMATPETFIAFTVQGGTAADGRC
KSFAEAADGAGWSEGVGMLVLERLSDARRNGHEVFAVMRSSAVNQDGASNGLTAPNGPSQ
QRVIRQALAAAGLSPTDVDAVEAHGTGTKLGDPIEAQALLSTYGHNRPDDRPLWLGSLKS
NIGHTQAAAGVGGVIKMVQALRHGILPRTLHVDRPTTHVEWEQGDVRLLTESIPWPETGR
PRRAGVSSFGVSGTNAHVILEAATADIDAEPAAEGDEPAADGAEVPIALGDFGADGVVPW
VLSGKTDEAVQAQAARLLEHLESVPALRPVDVGWSLAGFRSAFDHRAVVVGAGPDELTAG
LRALAAGRPAAEVLQGSTRGKRDAVFVFPGQGAQWVGMAQELIESSPVFASSMRECAEAL
EPFVDWSLADVLGDEAALQRVDVVQPALWAVMVSLAAVWQSAGVSPSAVVGHSQGEIAAA
CVAGALSLSDGARVVALRSRAIAEHLTGGGMMALSVPAAAARDLIADRPGVSLAAINGPS
SVVVSGEADALDSLQEYCEEQGIQARRIAVDYASHSHLVERIEDRLLADLAPVTPRSSSV
PVFSSVTGALMDTAEWDAGYWYRNLRNTVLFEQALTAAEPAVVIEVSPHPVLAPAVQDVA
PVVGTLRRGEGGLLRLVLALAQAWTHGAPVRWDAVFAGRSAVRVGLPTYAFQHQRYWPGP
ATSPADVAAAGLSPAEHPLLGAVVPLPHTDGVVFTSRLSLRTHPWLADHAVRGTVLLPGT
GFVELAVLAGDSVRCDRVDELVLEAPLVLPAQGGVQLQVVVGEAEPDTSRRGVAVYARPD
GQEEWTRHATGTVSAGAAGAGAEFDPVSRDWPVPGATEIDTGEFYEQLDAGGFLAYGPVF
RGLGRAWRAGDRILAEVELPEAGRGLAASFGIHPALLDAALHPAVFAEPAAARDDGLPFS
FTDIVLRAAGASRLRVALTRTGPDQLAIAVADSTGSPVLSIGSLTIRPVRAGAVTAGSGD
GTMLRIDWVETAPAEATADAADAVLLAAEGDPNEVVRSTHDLTARVLGQLQQHLGTDERP
VVVTTRGAIAADSGESVTDIAAAAVWGLVRSAQSEHPGRIVLLDSDTEVDAAVLGRVLTA
DEPQLVLRNGKLLAARLTRVTGADELTAPASSPELWRLDSTEKGTLENLALQPVPELAGP
LEQGQVRVRVRAAGLNFRDVLNALGMVDDPRAAGPLGGEISGVIVETGPGVTSLVPGDRV
MGIVPGGFGPEAVTDHRLLTTIPSGWSFVTAASVPVAFLTAYYGLVDLAGLRSGESLLVH
AGAGGVGSAAIQLARHLGAEVFATAHPAKWPVLHAQGLTTDRVASSRDLAFRERFQALDV
VLNSLAGEFVDASLDVLAPGGRFLEMGKTDIRSADDLREQRPGLSYQAFDLMDAGIDRIQ
EMLQEVARLFAVGVLKPLPVTAFDVRRGQDAFRHMSQARHVGKLVLTIPHALVPDGTVLI
TGGTGGLAGAVARHLVTEHGTRHLLLLSRRGPDAPGAAELIADLTRSGATAQVLACDVTD
RAALAEALAAVSPDHPLTGVVHTAGIIEDGLLGSITREQLDRVLAPKVDAAWHLHELTRD
LDLAMFVVFSSLAGFMGGGGQSNYAAGNVFLDALMQHRRRAGLPGLSMAWGAWTTEIGLV
GTLSEVDIARMARSAMPPMSVEQGLDLFDRALGTGHPVLGLTRLKVQALRAQHDAPLWRA
LTGGIARRTADNTRAGRHGLGERLAALPAAERRQILTDLVRDAAAAVLGHASGTQINADQ
PFSDLGFDSLTSVELRNLLRARTGVSLAAGAVFDYPTVARLAAHLATGFGEPETTETTTV
PAPVSVTGDPIVLVGMACRFPGGVADPDDLWQLVAGGIDGVTAFPADRGWDLDALLGADG
SAASATAEGGFLAGAGEFDAAFFRISPREALATDPQQRLLLEVSWEALERAGIDPGTLAG
SPTGVFAGAFGSGYGELVARSGEQLQGHLITGTAGSAISGRVAYALGLEGPAVSVDTACS
SSLVAMHLAAQALRAGECSLALAGGVTVMATADAFVGFTAQGGLSPDGRCRSFADSADGT
GWSEGVGVVVLERLSDAVRNGHEVLAVMRSSAVNQDGASNGLTAPNGPSQQRVIRQALAA
AGLSSADVDAVEAHGTGTRLGDPIEAQALLSTYGQDRPGDRPLWLGSLKSNIGHAQAAAG
VGGVIKMVMALRHGVLPRTLHVDEPSTQVDWTQGDVRLLTDAVPWPETGRPRRAGVSSFG
VSGTNAHVILEAPEATGPEPGPEPGSEVGGPVPWVLSARTAEAVRAQAARLVEHVEADPS
LRPVDVGWSLVDTRAVFDHRAVVVGSDREQLLAGVRHVSPVAAGADPRVGVLFTGQGAQR
VGMARGLYERSPVFAAALDEILAELDPLLERSLAGVMWGDDPGLVDRTGWAQPALFAVEA
ALFAVLRSYGVRPAFLLGHSIGEVTAAYVAGVWSLPDACRVVAARARLMQALPAGGAMAT
VQLPEADVVPLLPEGVAVAAVNTAGSVVVSGPRDAVEGLLASVSVKVTRLRVSHAFHSAL
MDPMLAEFARVLESVEFREPRIPVVSNLTGVVGDELTSPGYWVRQVRGTVRFADGVRWLG
EQGVSVLVEAGPDGVLSGLVDNSAPMLRRKRDDSEAVLAAVGHLWANGVAVDWAPAFEGL
DARRVKLPTYAFQHQRFWPDTTGGPADVAAAGLSAAEHPLLGAVLPLPQFDGVVFTSRLS
LRTHPWLADHAVRGVAVFPGAGFVELAVRAGDSVGCDHVDELVLEAPLVLPAQGGVQVQV
LVGAEADARRSIAVHARPDGEETWTRHATGTISATVAEAGPEFAPFARPWPGPEATELDT
AGFYERVREGGLLAYGPMFQGLHRAWRDGDRVLAEVELSDAARGTSFGLHPALLDAALQA
MAFAGLDAVESGGLPFSFSGVVLRATGASRLRVVLTPQGADQAAIVVADGAGSPVLSIGS
LTVRAAVAPGAAAGTGDRSLLAPQWPEIPVPDAEPVAEWVMVDPDAAAHAGLPEVATGTD
DEAQPRAVILPVSGDPDDVVESAHDRTAWVLEQLQVRLEGTAVPLVVVTRGAVAAQPGET
VTDLAAAAVWGLVRSAQTENPGRIVLLDTDAEVDAVLLGQVLAVGEPQLAWRQGRLHTAR
LYRTGRGDELPVPAAEVPWRLDTTGRGTLENLALVPRPELGEPLEAGQVRLDVRAAGLNF
RDVLNALGMYRGQAGPLGGEIAGVVTEVGHGVTGVRPGDRVLGLAFGSIGPVAVTDERLL
TAMPEDWSFATAAAVPIVFLTAYYGLVDLAGLHPGESVLIHAGAGGVGMAAIQLARHLGA
DVYATASEAKWPVLHERGVAQHRIASSRDLTFRERFRTATEGRGVDVVLNSLAGEFVDAS
LDVLAPGGRFLEMGKTDIRSAQELAPRANYAAFDLMDAGWDRIQEMLRDVMGLFGAGVLH
PLPVTAWDVRRAQDAFRHMSQARHVGKLVLTIPRALDPDGTVVITGGTGGLGGVMARHLA
DHGARKLLLLSRRGADAPGAAELVADLAQRGAVAEIVACDVADRSALAVALAARTVTGVV
HTAGVVEDGVLGSLSRDRLDRVLVPKVDAAWHLHELTCDQDLAMFVVFSSLAGISGGAGQ
GNYAAGNVFLDALMQHRRHAGLPGLSMAWGAWTTEIGLTGTLSRTDLARLARSAMPPLSA
EQGVELFDRALETGHPVLALTRLNIAALRNQQDLPAVWRALAGGSARRAADNVPSPHELP
AAERRRVLTDLVRETAASVLGHASAAQIDPDQPFNELGFDSLTSVELRNLLQSRTGLSLA
SSAVFDYPTVTRLAGYLAAESGDPAPDPALVPALVPVADDPIVIVGMACRYPGGVTDPDG
LWRVVTGEIDGITPFPADRGWDLDALLGADGSGTSMSATAEGGFIDGADEFDAQFFRISP
REALATDPQQRLLLEVSWEALEQAGIAPSSLVGTPTGVFAGAYQSGYTDIVDHGNEELRG
HLVTGGASSAISGRVAYTLGLEGPAVSVDTACSSSLVAMHLAAQALRSGECTLALAGGVT
VMATPGAIVGLTAQGPLAGDGRCKSFSDGADGAGWSEGVGMIVLERLSDAERHGHEVLAV
FRSSAVNQDGASNGLTAPNGPSQQRVIRQALAAAGLSTADVDAVEAHGTGTRLGDPIEAQ
ALLATYGHNRPDDRPLWLGSLKSNIGHTQAAAGVGGVIKMVMALRHGLLPKTLHVDAPTS
QVDWTKGNVRLLTSAVPWPENGHPRRAGVSSFGISGTNAHVILEAPSWAEVPPPVSADNE
GVVPWVLSGKTDDAARAQAARLLEHVESVPALRPVDVGWSLLETREAFDHRTVVVGSDRD
ELLDGLRAVTTGEQAPKQARRANRVVFVFPGQGGQWVGMAQDLLGSSPVFAASFAECQAA
LAAFVDWSLEDVLGDEVALKRVEVVQPVLWAVMVSLAAVWRSFGVEPDAVVGASQGEIAA
AVVAGELSLADGARVVALRSRLLAERMVGRGVLASIALPVERVRELLPEGLSIAGVNGPA
TVTVAGGQDAVEGFTARLTEEGVRARVVASSVATHCALVDDLEDDLAELLREVEPREGAV
PFYSTVDPGLREPGTLDAGYWFANMRRPVSFEPVVRELVESESLTFIEVGPHPVLLPPIQ
DIADLHATGSTVVVSTLRRNQGDLRRLVASVAQAYSYGVAVDWAPLFHGRGARRVALPTY
AFQRRRYWPEMTGGPAGVTAAGLDSAEHPLLGAMVTLPHSDGVLFTSRLSLRTHPWLADH
AVQGTVIFPGTGYVELAVRAGDSVGCDRLDELVLEAPLVLPAQGGVQVQLVVDAGGTQRA
FAVYARPDGQDEWTRHATGVLSSGAAQAGAEFDPVSQAWPAAGATEMDLSQFYAATDSYG
PQFQGLTRAWRHGDQILAEVELPEAARGAAGSYVIHPALLDAALHPAAFAGLSDGGLPFS
FTDVVLHASGAARLRVTMTRTGPDEVAVAVADGTGLPVLSIGALAVRPFNTGSLTGGADD
GAVLTLDWIGIDPAGIPVDSWTVADRTAPLGDETATLPVVLVVSGDPVTVAESSHELTGW
VLTQLQQWLGSESTVPLVVMTRGAVAVRTSSSAPASPEGARGEPVPDLPAAAVWGLVRSA
QTENPGRIVLLDTDSDLDAATLGNVLAADEPQLVLRDGRLHAGRLTRSRLSAGAPLEPAG
TVLITGGTGGLGGVVARHLVSAYGIRSLVLLSRRGADAPGAAELVAELSQQGAEAELVAC
DVADRSALAEVLASRSIGGVVHVAGVLDDGVIDTLSREQLDRVLAPKVDAAWHLHELTRD
LDLSMFVVFSSLAGILGGGGQGNYAAGNAFLDALMQQRRHDGLPGLSLAWGAWTTEVGRT
GELSEVDLRRIARSAIPPVAAGQGMELFDRALRAGSPVVALTRLNVRALRDQAGVPAVWR
ALAGGMLRRAADNTIDGRSGPAHRLAELAPADREKQLLDLVGDAASAVLGYAPGTRISAD
QPFKELGLDSLTAVELRNVLKTRTGLRLASSAVFDYPTVARLAAHLAAGFDDVRPAVPVT
VPALPPVTDDPVVIVGMACRFPGGVMNPDDLWQLVADEADGVAPFPTDRGWDLGRLLGTV
SRTAASAASEGGFVDGVDEFDAAFFRISPREALATDPQQRLLLEVSWEALEQAGIDPHSL
AGSPTGVFAGAYQSGYTELVARSGMDVQGHMITGAASSAISGRVAYALGLEGPAVSVDTA
CSSSMVSMHLAAQALRAGECSLALAGGVTVMAEPDVFIGFTVQGGMAADGRCKSFAEAAD
GAGWSEGAGMIVLERLSDAVRNGHEVLAVMRSSAVNQDGASNGLTAPNGPSQQRLIRQAL
AAAGLSSADVDAVEAHGTGTRLGDPIEAQALLSTYGQDRPGDRPLWLGSLKSNIGHTQAA
AGVGGVIKMVMALRHGILPRTLHVDAPTSQVDWTEGNVRLLTDAVPWPETGRPRRAGVSS
FGISGTNAHVILEAPEATGSEPEPGSGPEPRPEVGGPVPWVLSARTAEAVRAQAARLVEH
VEADPSLRPVDVGWSLVDTRAVFDHRAVVVGSDREQLLAGVRHVSPVAAGADPRVGVLFT
GQGAQRVGMARGLYERSPVFAAALDEIVAELDPLLERSLAGVMWGDDPGLVDRTGWAQPA
LFAVEAALFAVLRSYGVRPAFLLGHSIGEVTAAYVAGVWSLPDACRVVAARARLMQALPA
GGAMATVQLPEADVVPLLPEGVAVAAVNTAGSVVVSGPRDAVEGLLASVSVKVTRLRVSH
AFHSALMDPMLAEFARVLESVEFREPRIPVVSNLTGVVGDELTSPGYWVRQVRGTVRFAD
GVRWLGEQGVSVLVEAGPDGVLSGLVDNSAPMLRRKRDDSEAVLAAVGHLWANGVTVDWA
PVFEGRDARRVKLPTYAFQHQRFWPEVSAAAGDATSTGSRFDSELWASVEQQDTGTLAET
LGVDSALAASMLPALASWRDRHRDAETVNGWRYREAWKPLNIRSSSTKDRRWAVVVPAGG
SDDALVDAVTGALGTDVTVVEHDGMHTAEHGSHPLGDNDGTAIGSRFDGILFLSAVGGSD
PATMLTTVTDLLSKMPDDGVPLWVVTRGAVSVGAQDPVTAPGQAAVWGLGRVAALEQPAV
WGGLIDLPAQLDARSARALAAVLSDAAGEDQIAIRPAGTFGRRLTHAAAPGGPAPWKTSG
TALITGGTGGLGAHVARWITERGAEHVVLVSRRGPDADGADLLRLELETAGARVTVAACD
VTDRDALAQVVSEIPEEWPLRTVVHAAGVMGDPTLLTALTPRLLRHQLDPKVDGARHLDE
LTRDLELDAFVLFSSGAGVWGGGGQGAYAAANAFLDGLAAWRRSHGRPATSVAWGSWAEG
GMLADAESEHRERLGLLGLVPMRPHLALAALQRVLHDDETGLVVTDLDWARFAPVFTAAR
PSPLLSDLPEAAVALVQPDAASTERPALRLAGLSAAEREEALLTLVREAVAAVLGHAPGT
QVDDEQPFKELGFDSLTAVELRNVLQTRTGVGLAAGVVFDHPDPRSLAKALAAALRPADH
AEPQEAQSDYFGELFLQAMRTGELAQAQQLMAGAAQLRLKYGDPAGPEAVPEIVRLGRGQ
LGPQLILVCPTVMTTGPQVYSRLAEELDAGRRVSALVPPGFHGGQALPATLTVLVRSLAD
VVQAEVADGEFALAGHSSGGVVAYEVARELEARGLAPRGVVLIDSYSFDGDGGRPEELFR
SALNERFVEYLRLTGGGNLSQRITAQVWCLELLRGWRPEGLTAPTLYVRPAQPLVEQEKP
EWRGDVLAAMGQVVEAPGDHFTIIEGEHVASTAHIVGDWLREAHAHYSTEGWGGGLRTEE
selected fasta
>polyketide synthase [tautomycetin biosynthetic PKS]
GTGCCGTCGCCCGCCGGGCTCGGCCGGCCGACGACGGTCCCGACGAGGCTCTTCTGCTCG
ACGCCGACGTCGACGACCTCATCAACATCGCGCTTCGCGATCAGTGAACGACCAACCCGG
GAGCTGATGATGGCTGTGTCCGTTGACAAGCTGACGGAGGCCCTCCGCGCTTCGTTGCTG
GCCAACACCCGCCTGCGCCAGGAGAACAAGACCCTCGCCGACGCGGCGGGCGAGCCGATC
GCCATCGTGGGCATGGCCTGCCGCTATCCCGGCGGCGTGGCGGGCCCGGACGACCTGTGG
CGGCTGGTCGAGTCCGGTGGCGACGGCGTCGGCCCGTTCCCGGCCGACCGGGGCTGGGAC
CTCGACGAGCTGCTGGGGACCGCCGAATCCCCGCCCGCGTCGGTGACCAGCGAGGGCGGC
TTCCTGGCGGACGCGGGGGACTTCGACGCGGCCTTCTTCCGGATGTCGCCCCGCGAGGCG
CTGGCCACGGACCCGCAGCAGCGGCTGCTGCTGGAGACCTCGTGGGAGGCCCTGGAACAC
GCGGGGATCGATCCCGTCGCGCTCAAAGGCAGCCGGACCGGGGTGTTCGCCGGTGCCTAC
CAGATGGGCTACACCGGGCTGGTCACCGAATCCGACGAGCAGCTTCGCGGCCACGCTTTC
ACCGGAGGGGCGGGCAGCGTCACCTCCGGCCGGGTGGCGTACACGCTCGGCCTGGAGGGT
CCCGCGGTGAGCGTGGACACGGCGTGCTCGTCGTCGCTGGTGGCGATGCACCTGGCCGCG
CAGGCACTGCGGGCGGGGGAGTGCACGCTGGCGCTGGCGGGCGGCGTCACCGTCATGGCG
ACGCCGGAGACCTTCATCGCGTTCACGGTACAGGGCGGGACGGCCGCTGACGGGCGGTGC
AAGTCGTTCGCCGAGGCCGCGGACGGGGCCGGCTGGTCCGAGGGCGTCGGCATGCTGGTC
CTGGAGCGGCTGTCCGACGCTCGCCGCAACGGCCACGAGGTGTTCGCGGTCATGCGCTCG
AGCGCGGTCAACCAGGACGGCGCCTCCAACGGCCTGACCGCCCCGAACGGCCCCTCGCAG
CAGCGGGTGATCAGGCAGGCCCTGGCCGCAGCGGGCCTGTCGCCCACCGACGTGGATGCG
GTGGAGGCCCACGGCACGGGCACCAAGCTCGGCGACCCGATCGAGGCGCAGGCGCTGCTG
TCCACGTACGGCCACAACCGCCCCGACGACCGGCCGCTGTGGCTGGGATCCCTGAAGTCG
AACATCGGCCACACGCAAGCCGCGGCCGGCGTCGGCGGGGTCATCAAGATGGTGCAGGCG
CTGCGTCATGGGATCCTGCCCCGGACGCTGCACGTCGACCGCCCGACCACGCACGTCGAG
TGGGAACAGGGCGACGTCCGGCTGCTGACCGAGTCGATCCCGTGGCCGGAGACCGGCCGG
CCGCGCCGGGCCGGCGTCTCCTCGTTCGGGGTCAGCGGCACCAACGCGCACGTCATTCTC
GAGGCAGCGACCGCCGACATCGACGCCGAGCCGGCCGCCGAAGGTGACGAGCCCGCCGCG
GACGGCGCCGAGGTTCCGATCGCCCTGGGCGACTTCGGTGCGGACGGTGTGGTGCCGTGG
GTGCTGTCCGGCAAGACCGACGAGGCGGTGCAGGCGCAGGCGGCCCGCCTTCTGGAACAT
CTGGAATCGGTTCCGGCCCTGCGGCCGGTCGATGTCGGCTGGTCGCTGGCCGGGTTCCGC
TCGGCCTTCGACCACCGGGCCGTCGTGGTCGGCGCCGGACCGGACGAGCTGACGGCCGGA
CTGCGTGCCCTCGCCGCCGGCCGGCCGGCGGCTGAGGTGCTGCAGGGGAGTACACGCGGC
AAGCGCGACGCTGTCTTCGTGTTCCCGGGTCAGGGTGCGCAGTGGGTGGGGATGGCTCAG
GAGCTGATCGAGTCCTCGCCTGTCTTCGCCTCGTCGATGCGTGAGTGCGCGGAGGCCCTG
GAACCGTTCGTGGACTGGTCGCTGGCCGACGTGCTCGGCGACGAAGCTGCGCTGCAGCGG
GTGGATGTCGTGCAGCCGGCGCTGTGGGCGGTGATGGTGTCCCTGGCCGCGGTCTGGCAA
TCGGCCGGGGTTTCACCGTCCGCGGTGGTGGGTCATTCGCAGGGCGAGATCGCGGCGGCG
TGTGTGGCGGGTGCGTTGTCGTTGTCCGATGGTGCCCGGGTGGTGGCGTTGCGGAGCAGG
GCGATCGCGGAGCATCTGACCGGTGGCGGCATGATGGCGTTGTCGGTGCCGGCCGCGGCG
GCGCGGGACTTGATCGCGGACCGGCCCGGGGTGTCGCTGGCCGCGATCAACGGCCCGTCA
TCCGTGGTGGTCTCGGGCGAGGCCGACGCCCTGGACTCGCTGCAGGAATACTGCGAGGAG
CAGGGGATCCAGGCGCGCCGGATCGCGGTGGACTACGCCTCTCACTCGCATCTGGTCGAG
CGCATCGAGGACCGCTTGCTGGCGGATCTGGCTCCGGTCACCCCGCGGTCGTCGTCGGTG
CCGGTGTTCTCATCGGTGACCGGAGCGCTGATGGACACCGCGGAGTGGGACGCCGGGTAC
TGGTACCGGAACCTGCGCAACACCGTGCTGTTCGAGCAGGCTCTGACGGCGGCCGAGCCC
GCCGTGGTGATCGAGGTGAGTCCACATCCCGTGCTGGCGCCGGCGGTACAGGACGTCGCG
CCGGTCGTCGGAACGCTGCGACGCGGCGAGGGTGGCCTGCTCCGGCTGGTCCTGGCGCTC
GCCCAGGCATGGACCCACGGTGCCCCCGTGCGGTGGGATGCGGTCTTCGCCGGGCGCAGC
GCCGTGCGGGTCGGCCTGCCCACCTACGCGTTCCAGCACCAGCGCTACTGGCCAGGCCCG
GCCACGAGCCCCGCCGACGTCGCCGCCGCCGGGCTGAGCCCGGCCGAGCACCCGTTACTG
GGCGCCGTGGTGCCGCTGCCGCACACCGACGGGGTGGTGTTCACCAGCCGCCTCTCGCTG
CGCACCCACCCCTGGCTCGCCGACCACGCTGTACGCGGCACCGTGCTTCTGCCGGGAACC
GGTTTCGTGGAACTGGCCGTCCTGGCGGGCGACAGCGTGCGGTGCGACCGGGTGGACGAG
CTCGTCCTCGAGGCGCCGCTGGTGCTGCCCGCCCAGGGCGGTGTGCAGCTGCAGGTCGTC
GTGGGCGAGGCGGAGCCGGACACCTCCCGCCGCGGTGTCGCCGTGTACGCCCGGCCCGAC
GGGCAGGAGGAGTGGACCCGCCACGCCACGGGCACGGTGAGCGCCGGGGCCGCCGGTGCC
GGGGCGGAGTTCGACCCGGTGAGCCGCGACTGGCCCGTGCCCGGTGCGACGGAGATCGAC
ACCGGGGAGTTCTACGAGCAGCTCGACGCGGGCGGCTTCCTCGCGTACGGGCCGGTGTTC
CGGGGGTTGGGCCGGGCCTGGCGTGCCGGGGACCGGATCCTCGCCGAAGTCGAGCTGCCC
GAAGCCGGGCGCGGTCTCGCGGCATCGTTCGGGATCCACCCGGCGCTGCTGGACGCCGCG
CTGCACCCCGCGGTCTTCGCCGAGCCGGCCGCGGCGCGCGACGACGGCCTGCCGTTCAGC
TTCACCGACATCGTCCTGCGGGCCGCGGGCGCCTCCCGGCTGCGGGTGGCTCTGACAAGG
ACCGGTCCGGACCAGCTGGCGATCGCGGTCGCGGACAGCACGGGATCGCCGGTGCTGTCG
ATCGGATCGCTGACCATCCGTCCGGTGCGAGCCGGAGCCGTCACGGCCGGGTCCGGCGAC
GGCACCATGCTGCGGATCGACTGGGTCGAGACCGCGCCGGCCGAAGCGACCGCCGACGCC
GCCGACGCCGTGCTGCTGGCCGCCGAGGGTGACCCGAACGAAGTCGTGCGCTCCACCCAC
GACCTGACAGCGCGGGTTCTAGGACAACTGCAACAGCACCTCGGTACGGACGAGCGCCCG
GTGGTCGTGACGACCCGGGGCGCGATCGCGGCCGACTCCGGCGAATCCGTCACGGACATC
GCCGCGGCAGCGGTGTGGGGCCTGGTCCGCTCGGCGCAGAGCGAGCACCCCGGCCGGATC
GTCCTGCTCGACAGCGACACCGAGGTCGACGCCGCCGTGCTGGGCCGGGTGCTCACCGCG
GACGAACCGCAGCTGGTGCTGCGCAACGGCAAGCTGCTCGCCGCCCGCCTCACCCGGGTC
ACAGGCGCGGACGAGCTCACCGCGCCGGCGTCGTCGCCCGAGCTCTGGCGGCTCGACTCC
ACCGAGAAGGGCACGCTGGAGAATCTGGCCCTGCAACCGGTTCCCGAGCTGGCCGGCCCA
CTGGAACAGGGTCAGGTCCGGGTGCGCGTCCGGGCGGCGGGCCTCAACTTCCGGGACGTC
CTCAACGCCCTCGGCATGGTCGACGATCCGCGTGCCGCCGGGCCTCTGGGCGGGGAGATC
TCCGGTGTGATCGTCGAGACCGGGCCGGGCGTGACGAGCCTCGTGCCAGGCGACCGCGTC
ATGGGCATCGTGCCCGGTGGTTTCGGTCCGGAGGCGGTGACCGACCACCGGCTGCTGACG
ACGATCCCGTCCGGTTGGTCGTTCGTCACGGCTGCTTCGGTGCCGGTTGCGTTCCTGACG
GCGTACTACGGCCTGGTCGACCTCGCGGGCCTGCGGTCCGGCGAGTCCCTGCTGGTGCAC
GCCGGGGCCGGTGGGGTGGGGTCGGCGGCGATCCAGCTCGCTCGGCACCTCGGCGCGGAG
GTGTTCGCCACCGCGCATCCGGCCAAGTGGCCCGTACTGCACGCGCAAGGCCTCACGACG
GACCGGGTCGCATCCTCCCGGGATCTCGCCTTCCGTGAGCGTTTCCAGGCCCTGGACGTG
GTGCTCAACTCGCTGGCAGGCGAGTTCGTGGACGCCTCCCTCGACGTGCTGGCCCCGGGC
GGGCGGTTTCTCGAGATGGGCAAGACCGACATCCGGTCCGCCGATGATCTGCGCGAGCAG
CGCCCCGGGCTGAGCTACCAGGCGTTCGACCTGATGGACGCCGGTATCGACCGCATCCAG
GAAATGCTCCAGGAGGTGGCCCGGCTCTTCGCGGTCGGCGTGCTGAAGCCGTTGCCGGTC
ACGGCCTTCGACGTGCGCCGGGGACAGGACGCCTTCCGCCACATGAGCCAGGCCCGGCAT
GTCGGCAAGCTCGTGCTGACGATCCCGCACGCCCTCGTCCCCGACGGGACGGTCCTGATC
ACCGGCGGCACCGGAGGCCTGGCCGGCGCGGTGGCGCGGCACCTGGTCACCGAACACGGC
ACGCGTCATCTGTTGCTGCTGAGCCGCCGCGGGCCGGACGCGCCGGGGGCAGCGGAACTG
ATCGCGGACCTGACCCGCAGTGGCGCAACGGCCCAGGTGCTGGCCTGCGACGTGACCGAC
CGGGCGGCGCTGGCCGAGGCACTGGCGGCCGTCTCCCCGGACCACCCGCTGACCGGCGTC
GTGCACACCGCGGGCATCATCGAGGACGGCCTGCTCGGCTCGATCACCCGCGAGCAGCTG
GACCGCGTACTCGCACCCAAGGTCGACGCGGCCTGGCACCTGCACGAGCTCACGCGCGAC
CTGGATCTCGCGATGTTCGTGGTGTTCTCGTCCCTGGCCGGCTTCATGGGCGGCGGCGGG
CAGAGCAACTACGCCGCCGGAAACGTGTTTTTGGACGCGCTCATGCAGCACCGCCGCCGC
GCGGGTCTGCCGGGCCTGTCGATGGCGTGGGGCGCCTGGACGACCGAGATCGGCCTGGTC
GGCACCCTGTCGGAGGTCGACATCGCGCGGATGGCCCGGTCGGCCATGCCTCCCATGTCC
GTCGAACAGGGCCTCGACCTGTTCGACCGCGCGCTCGGCACCGGCCACCCGGTCCTCGGC
CTGACCCGGCTGAAGGTCCAGGCGCTGCGGGCTCAGCACGACGCCCCGCTGTGGCGTGCG
CTGACCGGTGGCATCGCGCGCCGCACCGCCGACAACACCCGCGCGGGCCGCCACGGGCTG
GGCGAGCGTCTCGCCGCACTTCCCGCAGCCGAGCGCCGGCAGATCCTCACCGACCTCGTC
CGCGATGCCGCCGCGGCCGTGCTCGGGCACGCCTCCGGCACGCAGATCAACGCCGACCAG
CCGTTCAGCGACCTCGGCTTCGACTCGCTGACCTCCGTCGAGCTGCGGAACCTGCTGCGC
GCCCGGACCGGCGTCAGCCTCGCCGCCGGCGCCGTGTTCGACTATCCGACCGTCGCCCGC
CTGGCCGCGCACCTGGCGACCGGCTTCGGTGAGCCGGAGACCACGGAGACGACCACGGTG
CCGGCGCCGGTGTCGGTCACCGGTGACCCGATCGTCCTGGTCGGCATGGCCTGCCGATTC
CCGGGCGGGGTGGCCGACCCCGACGACCTGTGGCAGCTCGTCGCCGGCGGCATCGACGGC
GTCACTGCTTTTCCGGCCGACCGCGGCTGGGACCTCGACGCGCTCCTCGGCGCCGACGGG
TCCGCGGCGTCGGCCACGGCCGAAGGCGGCTTCCTCGCCGGCGCCGGCGAGTTCGACGCC
GCCTTCTTCCGCATCTCGCCGCGCGAGGCCCTGGCGACCGACCCGCAGCAGCGGTTGCTG
CTGGAGGTGTCGTGGGAGGCCCTGGAGCGGGCGGGAATCGATCCCGGAACGCTGGCCGGC
AGCCCGACCGGCGTCTTCGCCGGGGCCTTCGGATCGGGGTACGGGGAACTCGTCGCCCGC
TCCGGCGAGCAGCTCCAGGGCCATCTCATCACCGGCACAGCGGGCAGTGCGATCTCGGGG
CGGGTTGCGTACGCGCTGGGGCTGGAGGGTCCCGCGGTGAGCGTGGACACGGCGTGTTCG
TCGTCGCTGGTGGCGATGCATCTGGCCGCGCAGGCGCTGCGGGCGGGGGAGTGTTCGTTG
GCGCTGGCCGGCGGCGTCACCGTCATGGCCACTGCGGATGCCTTCGTGGGCTTCACCGCG
CAGGGTGGTCTGTCCCCGGACGGCCGGTGCCGGTCGTTCGCCGACAGCGCTGACGGGACG
GGCTGGTCCGAGGGCGTCGGTGTGGTGGTGCTGGAGCGGCTGTCCGACGCTGTGCGCAAC
GGCCACGAGGTTCTCGCGGTCATGCGGTCGAGTGCGGTGAATCAGGACGGTGCGTCGAAT
GGTCTGACCGCGCCGAACGGTCCGTCCCAGCAGCGGGTGATCCGTCAGGCGCTGGCGGCG
GCGGGTCTGTCGTCGGCTGACGTGGATGCGGTGGAGGCCCATGGGACGGGCACCAGGCTC
GGTGATCCGATCGAGGCGCAGGCGCTGCTGTCCACGTATGGCCAGGACCGTCCCGGCGAC
CGGCCGTTGTGGCTGGGGTCGTTGAAGTCGAACATCGGCCATGCGCAGGCTGCCGCGGGT
GTCGGTGGTGTGATCAAGATGGTCATGGCGCTGCGTCATGGGGTCCTGCCCAGGACTCTG
CATGTCGATGAGCCGTCGACTCAGGTCGACTGGACGCAGGGTGATGTGCGGCTGCTGACC
GATGCGGTGCCGTGGCCGGAGACCGGTCGTCCGCGCCGGGCCGGGGTGTCCTCGTTCGGT
GTCAGTGGTACCAACGCGCATGTCATCCTCGAAGCCCCCGAGGCAACCGGGCCCGAGCCC
GGGCCTGAGCCCGGGTCCGAGGTTGGCGGCCCGGTGCCGTGGGTGTTGTCTGCCAGGACG
GCTGAGGCGGTGCGTGCTCAGGCGGCGAGGCTGGTGGAGCATGTGGAAGCGGATCCGTCG
TTGCGGCCGGTGGATGTCGGCTGGTCGTTGGTGGATACGCGTGCGGTGTTCGACCATCGT
GCCGTCGTGGTGGGCAGTGACCGTGAGCAGCTTCTCGCCGGTGTGCGTCATGTGTCTCCG
GTTGCTGCGGGGGCGGATCCGCGGGTGGGTGTGTTGTTCACCGGTCAGGGTGCGCAGCGG
GTGGGTATGGCCCGGGGTTTGTATGAGAGGTCGCCGGTGTTCGCGGCGGCGTTGGATGAG
ATCCTCGCGGAGTTGGATCCCCTGCTGGAGCGTTCTTTGGCCGGGGTGATGTGGGGTGAT
GATCCGGGTCTGGTGGATCGGACGGGGTGGGCGCAGCCGGCGCTTTTCGCGGTGGAGGCG
GCGCTGTTCGCGGTGCTGCGTTCGTATGGGGTGCGTCCGGCTTTTCTGCTGGGTCATTCC
ATTGGTGAGGTGACGGCTGCGTATGTGGCGGGGGTGTGGTCGCTTCCTGATGCGTGTCGG
GTGGTGGCGGCGCGGGCGAGGCTGATGCAGGCGTTGCCGGCTGGTGGGGCGATGGCCACG
GTTCAGTTGCCCGAGGCGGATGTCGTTCCGTTGTTGCCTGAGGGGGTGGCGGTCGCCGCG
GTCAACACGGCGGGTTCGGTGGTGGTGTCGGGTCCGCGGGATGCGGTGGAGGGGCTGCTG
GCATCGGTTTCGGTGAAGGTGACGCGGTTGAGGGTGTCGCATGCGTTCCACTCGGCGTTG
ATGGATCCGATGCTGGCGGAGTTTGCGCGGGTGTTGGAGTCGGTGGAGTTCCGGGAGCCG
CGGATTCCGGTGGTGTCGAACTTGACCGGTGTGGTGGGTGACGAGTTGACGTCGCCTGGT
TATTGGGTGCGGCAGGTGCGGGGCACGGTCCGGTTCGCCGATGGGGTGCGGTGGCTGGGT
GAGCAGGGTGTGAGCGTGTTGGTGGAGGCTGGTCCGGACGGGGTGTTGTCGGGGCTGGTG
GACAACAGTGCACCGATGCTGCGGCGCAAGCGTGACGACAGCGAGGCGGTGCTGGCCGCG
GTCGGGCATCTCTGGGCGAACGGCGTCGCCGTGGACTGGGCGCCGGCTTTCGAGGGCCTG
GACGCGCGGCGGGTCAAGCTGCCGACGTATGCCTTCCAGCACCAGCGCTTCTGGCCCGAC
ACCACCGGCGGGCCGGCCGATGTCGCCGCGGCCGGGCTGAGCGCGGCCGAGCATCCGTTG
CTGGGGGCAGTGCTGCCACTGCCGCAGTTCGACGGGGTCGTGTTCACCAGCCGCCTGTCG
CTGCGCACCCATCCCTGGCTCGCCGACCACGCCGTCCGGGGCGTGGCCGTGTTCCCCGGC
GCCGGATTCGTCGAGCTCGCCGTCCGCGCCGGGGACAGCGTCGGCTGCGACCACGTCGAC
GAGCTCGTTCTGGAGGCCCCGCTGGTGCTGCCCGCCCAGGGCGGTGTCCAGGTGCAGGTC
TTGGTCGGCGCCGAGGCTGACGCGCGGCGCAGCATCGCGGTCCACGCCCGGCCGGACGGC
GAGGAGACGTGGACCCGGCACGCCACCGGAACGATCAGCGCCACCGTGGCCGAGGCGGGA
CCGGAGTTCGCCCCGTTCGCCCGGCCGTGGCCTGGACCGGAGGCGACCGAGTTGGACACC
GCGGGCTTCTACGAGCGGGTGCGGGAGGGCGGGCTCCTCGCGTACGGTCCGATGTTCCAG
GGTCTGCACCGCGCCTGGCGGGATGGGGACCGCGTCCTCGCCGAGGTGGAGCTGTCTGAC
GCGGCCCGGGGCACGTCGTTCGGGCTGCACCCGGCGCTGCTGGACGCCGCGCTGCAGGCC
ATGGCCTTCGCCGGGCTCGACGCGGTGGAAAGCGGCGGGCTGCCGTTCAGCTTCTCCGGT
GTGGTCCTGCGCGCCACCGGGGCGTCCCGGCTGCGCGTCGTCCTGACCCCGCAGGGTGCG
GACCAGGCCGCGATCGTGGTCGCGGACGGCGCCGGGTCACCGGTGCTGTCGATCGGCTCG
CTGACCGTCCGGGCGGCCGTGGCTCCGGGCGCCGCAGCCGGTACGGGCGACCGGTCCCTG
CTTGCCCCGCAGTGGCCCGAGATCCCGGTCCCGGACGCGGAACCGGTGGCCGAGTGGGTG
ATGGTCGACCCGGATGCCGCGGCCCACGCCGGCCTTCCCGAGGTCGCGACCGGCACCGAC
GACGAGGCGCAACCGCGCGCTGTGATTCTGCCGGTATCCGGAGACCCGGACGACGTGGTG
GAGTCCGCCCACGACCGCACCGCCTGGGTGCTGGAGCAGCTGCAGGTCCGGCTTGAGGGG
ACCGCGGTCCCGCTGGTCGTCGTCACCCGCGGCGCGGTTGCCGCACAGCCCGGCGAGACC
GTGACGGATCTGGCTGCGGCGGCGGTGTGGGGTCTGGTGCGCTCGGCGCAGACCGAGAAC
CCGGGCCGGATCGTGCTGCTCGACACCGACGCCGAGGTGGACGCGGTGCTGCTGGGCCAG
GTCCTTGCCGTCGGCGAACCGCAGCTGGCGTGGCGCCAAGGCCGGTTGCACACCGCGCGC
CTGTACCGGACCGGTCGAGGCGACGAGCTTCCCGTCCCGGCGGCGGAGGTCCCATGGCGG
CTGGACACCACGGGACGTGGCACGCTCGAGAACCTGGCGCTCGTGCCCCGGCCCGAGCTG
GGGGAACCGCTGGAGGCGGGCCAGGTCCGGCTCGACGTACGCGCGGCGGGCCTCAACTTC
CGCGACGTCCTCAACGCCCTCGGCATGTATCGCGGCCAGGCCGGCCCGCTCGGCGGCGAG
ATCGCGGGCGTGGTCACCGAGGTGGGGCACGGGGTCACCGGGGTGCGGCCCGGCGACCGG
GTGCTGGGTCTGGCCTTCGGGTCGATCGGGCCGGTTGCCGTGACCGACGAGCGGCTGCTC
ACCGCGATGCCCGAGGACTGGTCGTTCGCCACTGCCGCAGCGGTGCCGATCGTGTTCCTG
ACCGCCTATTACGGACTGGTCGACCTGGCCGGCCTGCACCCTGGGGAATCGGTTCTGATC
CACGCCGGCGCCGGCGGCGTAGGCATGGCGGCCATCCAGCTCGCGCGGCATCTCGGCGCG
GACGTCTACGCCACCGCGAGCGAGGCGAAATGGCCGGTCCTGCACGAGCGTGGCGTGGCG
CAGCACCGGATCGCGTCCTCGCGGGACCTGACGTTCCGGGAACGGTTCCGGACCGCCACG
GAGGGCCGCGGCGTCGACGTGGTGCTCAACTCTTTGGCCGGCGAGTTCGTGGACGCCTCG
CTCGACGTGCTGGCCCCCGGCGGGCGCTTCCTCGAGATGGGCAAGACCGACATTCGGTCG
GCGCAGGAGCTCGCGCCGCGGGCCAACTACGCGGCTTTCGACCTCATGGACGCGGGTTGG
GACCGTATCCAGGAAATGCTGCGAGACGTGATGGGCTTGTTCGGCGCAGGTGTTCTGCAC
CCGCTGCCCGTCACCGCCTGGGACGTCCGCCGGGCGCAGGACGCCTTCCGGCACATGAGC
CAGGCCCGGCACGTCGGCAAGCTGGTGCTGACGATCCCCCGGGCCCTCGACCCGGACGGT
ACGGTTGTCATCACCGGTGGCACCGGAGGTCTCGGTGGCGTCATGGCCCGGCACCTTGCC
GACCACGGTGCCCGCAAGCTGCTGCTGCTGAGCCGACGTGGTGCGGACGCCCCCGGCGCC
GCCGAACTCGTCGCCGACCTGGCGCAGCGCGGTGCCGTCGCCGAGATCGTGGCGTGCGAC
GTGGCGGACCGTTCGGCGCTGGCCGTGGCGCTGGCCGCCAGGACCGTCACCGGCGTCGTG
CACACCGCGGGCGTGGTCGAGGACGGCGTCCTCGGGTCGCTCTCGCGTGACCGCCTGGAC
CGGGTGCTCGTACCGAAGGTCGACGCGGCCTGGCACCTGCACGAGCTGACCTGCGACCAG
GACCTGGCGATGTTCGTGGTGTTCTCCTCCCTCGCCGGGATCTCGGGCGGGGCCGGGCAG
GGAAACTACGCCGCCGGCAACGTGTTCCTGGACGCGTTGATGCAGCACCGCCGCCACGCG
GGCCTGCCGGGCCTGTCGATGGCGTGGGGCGCGTGGACGACTGAGATCGGCCTGACGGGC
ACCCTGTCGCGCACGGATCTGGCCCGGCTCGCCCGGTCGGCCATGCCGCCGCTCTCCGCC
GAGCAGGGAGTGGAGCTGTTCGACCGGGCGCTGGAGACCGGCCACCCGGTGTTGGCGCTT
ACCCGGCTCAACATCGCGGCCCTGCGGAACCAGCAGGACCTTCCGGCCGTGTGGCGCGCG
CTGGCCGGCGGCTCCGCACGCCGCGCCGCCGACAACGTGCCCTCGCCGCACGAGTTGCCC
GCCGCCGAGCGCCGGCGGGTCCTGACCGATCTCGTCCGCGAGACGGCCGCATCCGTGCTG
GGTCACGCCTCCGCCGCGCAGATCGATCCGGACCAGCCGTTCAACGAGCTGGGCTTCGAC
TCGCTGACCTCCGTGGAACTGCGCAACCTGCTGCAGTCTCGAACCGGTTTGAGTCTGGCC
TCCAGCGCGGTGTTCGACTATCCGACCGTCACGCGGCTGGCCGGATATCTGGCCGCGGAG
TCCGGAGACCCGGCTCCGGATCCGGCCCTGGTGCCGGCGCTCGTGCCGGTCGCCGACGAC
CCGATCGTCATCGTGGGCATGGCCTGCCGGTACCCCGGCGGGGTCACGGACCCCGACGGC
CTGTGGCGCGTCGTCACCGGCGAGATCGACGGCATCACCCCGTTCCCGGCCGACCGCGGC
TGGGACCTGGACGCGCTGCTCGGCGCGGACGGGTCCGGAACGAGCATGTCCGCCACCGCC
GAGGGTGGTTTCATCGACGGCGCCGACGAGTTCGACGCGCAGTTCTTCCGCATCTCGCCC
CGCGAGGCTCTGGCCACGGATCCGCAGCAGCGGTTGCTGCTCGAAGTGTCGTGGGAGGCG
CTGGAACAAGCGGGAATCGCTCCCTCATCGCTGGTGGGGACCCCGACCGGCGTCTTCGCC
GGCGCCTACCAGTCCGGCTACACCGACATCGTCGACCACGGCAACGAAGAGCTGCGCGGC
CACCTGGTGACCGGCGGCGCGAGCAGCGCGATCTCGGGCCGGGTCGCGTACACGCTGGGC
CTGGAGGGTCCCGCGGTCAGCGTGGACACCGCCTGCTCCTCGTCGCTCGTGGCGATGCAC
CTGGCCGCCCAGGCCCTGCGGTCGGGCGAGTGCACGCTCGCTCTCGCGGGCGGCGTCACC
GTCATGGCCACACCCGGGGCGATCGTCGGGCTCACGGCGCAGGGCCCGCTCGCCGGCGAC
GGGCGGTGCAAGTCGTTCTCCGACGGTGCCGACGGCGCGGGCTGGTCGGAGGGCGTCGGC
ATGATCGTGCTGGAACGCCTGTCCGACGCCGAGCGCCACGGCCACGAGGTGCTGGCCGTG
TTCCGCTCGAGCGCGGTCAACCAGGACGGTGCCTCCAACGGCCTCACCGCCCCGAACGGC
CCGTCTCAGCAGCGTGTCATCCGCCAAGCCCTGGCTGCTGCCGGTCTGTCGACGGCTGAC
GTGGATGCGGTGGAGGCCCACGGTACGGGCACCCGCCTCGGCGACCCGATCGAAGCCCAA
GCACTGCTCGCCACGTACGGCCACAACCGCCCCGACGACCGGCCGCTGTGGTTGGGATCC
CTGAAGTCGAACATCGGCCACACCCAGGCCGCGGCGGGTGTCGGCGGTGTGATCAAGATG
GTCATGGCCCTGCGTCACGGACTGCTGCCCAAGACGCTGCACGTGGACGCGCCTACCTCC
CAGGTCGACTGGACGAAGGGCAACGTACGGCTGCTGACGTCAGCGGTGCCGTGGCCCGAG
AACGGCCATCCGCGCCGCGCCGGCGTCTCCTCGTTCGGCATCAGCGGCACCAACGCCCAC
GTGATCCTCGAAGCCCCGTCCTGGGCCGAGGTGCCACCGCCGGTGAGCGCCGACAACGAG
GGCGTGGTGCCCTGGGTGCTGTCCGGTAAGACCGACGACGCCGCACGGGCACAAGCCGCG
CGACTGCTGGAACACGTGGAATCGGTTCCCGCTCTGCGCCCGGTGGACGTGGGCTGGTCG
CTGCTGGAAACCCGGGAGGCGTTCGATCACCGGACCGTGGTGGTCGGCAGCGATCGTGAC
GAGTTGCTCGACGGCCTGCGCGCCGTGACGACCGGCGAGCAGGCACCGAAACAGGCCCGC
CGCGCGAACCGGGTGGTGTTCGTCTTCCCCGGCCAGGGCGGCCAGTGGGTCGGCATGGCC
CAGGACCTGCTGGGATCCTCGCCGGTGTTCGCCGCGTCCTTCGCCGAGTGCCAGGCCGCC
CTGGCGGCGTTCGTGGACTGGTCGCTGGAGGACGTACTCGGTGACGAGGTCGCGCTCAAG
CGGGTGGAGGTCGTCCAGCCCGTGCTGTGGGCCGTGATGGTGTCCCTGGCGGCGGTGTGG
CGGTCCTTCGGTGTGGAGCCGGACGCTGTCGTCGGCGCCAGTCAGGGCGAGATCGCGGCG
GCCGTCGTGGCAGGCGAGCTGAGCCTGGCGGACGGCGCGCGGGTCGTGGCGTTGCGCAGC
CGGCTGCTGGCCGAGCGGATGGTCGGCCGCGGCGTGCTGGCCTCGATCGCGCTGCCGGTC
GAGCGGGTCCGCGAGCTGTTGCCTGAAGGTTTGAGCATTGCCGGGGTCAACGGACCCGCG
ACGGTGACCGTGGCCGGCGGGCAGGACGCGGTGGAGGGCTTCACCGCGCGGCTGACCGAG
GAGGGCGTCCGGGCCCGGGTGGTCGCCTCGTCCGTGGCCACCCACTGCGCGCTGGTGGAC
GACCTCGAGGACGACCTGGCTGAGCTTCTGCGGGAGGTCGAGCCACGCGAGGGGGCTGTG
CCGTTCTACTCGACGGTGGATCCGGGCCTGCGGGAGCCGGGAACCCTCGACGCGGGCTAC
TGGTTCGCGAACATGCGCCGGCCGGTGTCCTTCGAGCCGGTCGTACGGGAACTGGTCGAG
TCGGAGTCGTTGACGTTCATCGAAGTCGGGCCGCATCCTGTGCTGCTGCCCCCGATCCAG
GACATCGCCGACCTCCATGCGACCGGGTCGACGGTCGTGGTGAGCACCCTGCGCCGCAAC
CAGGGCGATCTGCGGCGGCTGGTCGCGTCGGTGGCGCAGGCTTACTCGTACGGGGTCGCA
GTCGACTGGGCTCCGTTGTTCCACGGGCGCGGGGCACGCCGGGTCGCCCTGCCCACGTAC
GCGTTCCAGCGCCGGCGGTACTGGCCCGAGATGACAGGCGGCCCGGCCGGTGTGACGGCG
GCCGGGCTGGATTCGGCGGAGCACCCGCTGCTCGGGGCCATGGTGACGTTGCCGCACAGT
GACGGGGTGCTGTTCACGAGCCGGCTGTCCCTGCGCACCCACCCGTGGCTCGCCGATCAC
GCCGTGCAGGGAACCGTGATCTTCCCCGGTACGGGCTATGTCGAGCTGGCCGTCCGGGCC
GGTGACAGCGTCGGTTGCGACAGGCTGGACGAACTCGTTCTGGAAGCACCGCTGGTGCTG
CCCGCCCAGGGCGGAGTCCAGGTGCAACTGGTGGTCGACGCGGGCGGGACACAGCGTGCG
TTTGCGGTGTACGCCCGGCCCGACGGGCAGGACGAGTGGACGCGGCATGCCACCGGTGTG
CTGAGTTCCGGTGCCGCGCAGGCCGGCGCCGAGTTCGATCCGGTGAGCCAGGCGTGGCCC
GCCGCGGGCGCGACCGAAATGGATCTGAGTCAGTTCTATGCCGCCACGGATTCCTACGGC
CCGCAGTTCCAGGGGCTGACCCGGGCGTGGCGGCACGGGGACCAGATCCTGGCCGAGGTT
GAGCTGCCCGAGGCCGCGCGGGGCGCCGCCGGGTCGTACGTGATCCATCCGGCCCTGCTC
GACGCCGCCCTGCACCCTGCGGCCTTCGCCGGGCTGAGCGACGGCGGCCTGCCGTTCAGC
TTCACCGACGTGGTGCTGCACGCCTCGGGTGCCGCGCGGCTGCGGGTCACGATGACGCGT
ACGGGTCCGGACGAGGTGGCTGTCGCCGTTGCCGACGGCACGGGACTGCCCGTGCTGTCG
ATCGGGGCGCTCGCGGTGCGGCCGTTCAACACCGGCTCCCTGACCGGCGGCGCGGACGAC
GGTGCTGTGCTCACCCTGGACTGGATCGGCATCGACCCGGCCGGCATCCCGGTGGACAGC
TGGACGGTGGCCGACCGCACGGCCCCGCTCGGCGACGAGACGGCGACGCTGCCGGTGGTG
CTGGTGGTCTCCGGCGACCCGGTTACGGTGGCGGAGTCCTCCCACGAGTTGACCGGCTGG
GTGCTGACGCAGCTTCAGCAGTGGCTGGGCAGTGAGAGCACGGTTCCACTGGTGGTCATG
ACCCGCGGTGCGGTTGCCGTACGGACCTCTTCCTCGGCGCCCGCTTCCCCGGAGGGCGCG
CGGGGGGAACCGGTTCCCGACCTTCCGGCAGCCGCCGTCTGGGGCCTCGTACGGTCGGCG
CAGACGGAGAATCCCGGCCGGATCGTGCTGCTCGACACCGACAGCGACCTGGACGCCGCC
ACGCTGGGCAACGTCCTCGCCGCCGATGAGCCGCAACTGGTGTTGCGGGACGGCCGGCTC
CACGCGGGTCGCCTGACTCGCTCCCGTCTCTCGGCCGGGGCCCCTCTGGAACCGGCTGGA
ACCGTTCTCATCACGGGTGGCACCGGTGGGCTGGGCGGTGTGGTGGCGCGGCACCTCGTG
TCCGCGTACGGCATCCGGAGCCTGGTGCTGCTGAGCCGGCGCGGCGCCGACGCCCCGGGC
GCGGCGGAGCTGGTGGCCGAGCTGTCGCAGCAGGGTGCCGAGGCCGAGCTCGTGGCGTGC
GACGTGGCCGACCGGTCGGCGCTCGCCGAGGTGCTGGCCTCCCGTTCGATCGGCGGCGTC
GTGCATGTCGCGGGTGTCCTCGACGACGGCGTGATCGACACCCTGTCGCGCGAGCAGCTC
GACCGGGTGCTCGCCCCGAAGGTGGACGCGGCCTGGCACCTGCACGAGTTGACCCGCGAC
CTCGACCTGTCGATGTTCGTGGTCTTCTCCTCCCTCGCCGGCATCCTGGGCGGCGGCGGC
CAGGGCAACTACGCTGCGGGCAACGCCTTCCTGGACGCGCTCATGCAGCAACGCCGCCAC
GACGGGCTGCCGGGCCTCTCGCTTGCCTGGGGCGCCTGGACCACTGAGGTGGGCCGTACG
GGTGAGCTGTCCGAGGTCGACCTCCGGCGCATTGCCCGCTCGGCGATTCCGCCGGTCGCC
GCCGGCCAGGGCATGGAGCTCTTCGATCGGGCACTGCGCGCCGGCTCGCCGGTGGTGGCG
CTCACCCGGCTCAACGTCCGGGCCCTGCGGGATCAGGCCGGTGTGCCGGCCGTGTGGCGT
GCGCTGGCGGGCGGGATGCTGCGGCGGGCCGCGGACAACACCATCGACGGTCGCAGCGGA
CCGGCGCACCGGCTGGCCGAGCTGGCCCCGGCGGACCGGGAGAAGCAGCTGCTCGACTTG
GTCGGCGACGCCGCCTCAGCGGTGCTCGGCTACGCCCCGGGCACGCGGATCAGCGCCGAC
CAGCCGTTCAAGGAGCTCGGCTTGGACTCCCTGACGGCGGTCGAGCTGCGCAACGTGCTG
AAGACCCGGACCGGCCTGCGCCTGGCGTCCAGCGCGGTGTTCGACTACCCGACCGTGGCC
CGGCTCGCGGCCCACCTGGCCGCCGGGTTCGACGACGTACGTCCGGCGGTTCCGGTGACC
GTCCCGGCGCTCCCGCCGGTCACCGACGACCCGGTCGTCATCGTGGGCATGGCCTGCCGC
TTCCCTGGCGGTGTCATGAACCCCGACGACCTGTGGCAGCTGGTGGCCGACGAGGCTGAC
GGCGTCGCGCCGTTCCCGACCGACCGCGGCTGGGACCTCGGCCGCCTCCTGGGAACCGTT
TCCAGGACGGCCGCTTCCGCGGCGAGCGAAGGCGGCTTCGTCGACGGGGTGGACGAGTTC
GACGCGGCGTTCTTCCGCATCTCGCCCCGTGAGGCCCTCGCCACCGACCCGCAGCAGCGG
TTGCTGCTGGAGGTGTCGTGGGAGGCGCTGGAACAGGCGGGAATCGATCCCCACTCCCTG
GCCGGCAGCCCCACCGGCGTCTTCGCAGGCGCCTACCAGTCCGGCTACACCGAGCTCGTT
GCCCGCAGCGGCATGGACGTGCAGGGCCACATGATCACCGGCGCGGCGAGCAGTGCGATC
TCGGGGCGGGTTGCGTATGCGCTGGGGCTGGAGGGTCCCGCGGTCAGCGTGGACACCGCC
TGCTCCTCATCGATGGTCTCGATGCACCTGGCGGCCCAGGCTCTGCGAGCCGGGGAGTGC
TCGCTGGCGCTGGCCGGTGGTGTCACGGTGATGGCCGAGCCGGACGTGTTCATCGGCTTC
ACGGTCCAGGGCGGCATGGCCGCGGACGGCCGCTGCAAGTCGTTCGCCGAGGCGGCCGAC
GGCGCGGGCTGGTCCGAGGGCGCTGGCATGATCGTGCTGGAGCGGCTGTCCGACGCCGTG
CGCAACGGCCACGAGGTTCTCGCGGTCATGCGGTCGAGTGCGGTGAATCAGGACGGTGCG
TCGAATGGTCTGACGGCTCCGAACGGTCCGTCTCAGCAGCGTTTGATCCGTCAGGCTCTG
GCGGCTGCCGGTCTGTCGTCGGCTGACGTGGATGCGGTGGAGGCCCATGGGACGGGCACC
CGCCTCGGTGATCCGATCGAGGCGCAGGCGCTGCTGTCCACGTATGGCCAGGACCGTCCC
GGCGATCGCCCGTTGTGGCTGGGGTCGTTGAAGTCGAACATCGGTCACACTCAGGCTGCC
GCGGGTGTCGGTGGTGTGATCAAGATGGTCATGGCGCTGCGTCACGGGATCCTGCCCAGG
ACCCTGCACGTGGACGCGCCGACCTCGCAGGTGGACTGGACCGAGGGGAATGTGCGGCTG
CTGACCGATGCGGTGCCGTGGCCGGAGACCGGTCGTCCGCGCCGTGCCGGGGTGTCCTCG
TTCGGTATCAGTGGTACCAACGCGCATGTCATCCTCGAAGCCCCCGAGGCAACCGGGTCC
GAGCCCGAGCCCGGGTCCGGGCCTGAGCCCAGGCCGGAGGTTGGCGGCCCGGTGCCGTGG
GTGTTGTCTGCCAGGACGGCTGAGGCGGTGCGTGCTCAGGCGGCGAGGCTGGTGGAGCAT
GTGGAAGCGGATCCGTCGTTGCGGCCGGTGGATGTCGGCTGGTCGTTGGTGGATACGCGT
GCGGTGTTCGATCATCGTGCCGTCGTGGTGGGCAGTGACCGTGAGCAGCTTCTCGCCGGT
GTGCGTCATGTGTCTCCGGTTGCTGCGGGGGCGGATCCGCGGGTGGGTGTGTTGTTCACC
GGTCAGGGTGCGCAGCGGGTGGGTATGGCCCGGGGTTTGTATGAGAGGTCGCCGGTGTTC
GCGGCGGCGTTGGATGAGATTGTCGCGGAGTTGGATCCCCTGCTGGAGCGTTCTTTGGCC
GGGGTGATGTGGGGTGATGATCCGGGTCTGGTGGATCGGACGGGGTGGGCGCAGCCGGCG
CTTTTCGCGGTGGAGGCGGCGCTGTTCGCGGTGCTGCGTTCGTATGGGGTGCGTCCGGCT
TTTCTGCTGGGTCATTCCATTGGTGAGGTGACGGCTGCGTATGTGGCGGGGGTGTGGTCG
CTTCCTGATGCGTGTCGGGTGGTGGCGGCGCGGGCGAGGCTGATGCAGGCGTTGCCGGCT
GGTGGGGCGATGGCCACGGTTCAGTTGCCCGAGGCGGATGTCGTTCCGTTGTTGCCTGAG
GGGGTGGCGGTCGCCGCGGTCAATACTGCGGGTTCGGTGGTGGTGTCGGGTCCGCGGGAT
GCGGTGGAGGGGTTGCTGGCGTCGGTTTCGGTGAAGGTGACGCGGTTGAGGGTGTCGCAT
GCGTTCCACTCGGCGTTGATGGATCCGATGCTGGCGGAGTTTGCGCGGGTGTTGGAGTCG
GTGGAGTTCCGGGAGCCGCGGATTCCGGTGGTGTCGAACTTGACCGGTGTGGTGGGTGAC
GAGTTGACGTCGCCTGGTTATTGGGTGCGGCAGGTGCGGGGCACGGTCCGGTTCGCCGAT
GGGGTGCGGTGGCTGGGTGAGCAGGGTGTGAGCGTGTTGGTGGAGGCTGGTCCGGACGGG
GTGTTGTCGGGGCTGGTGGACAACAGTGCACCGATGCTGCGGCGCAAGCGTGACGACAGC
GAGGCGGTGCTGGCCGCGGTCGGGCATCTCTGGGCGAACGGCGTCACCGTGGACTGGGCG
CCGGTGTTCGAGGGTCGGGACGCGCGGCGGGTCAAGCTGCCGACGTATGCGTTCCAGCAC
CAGCGCTTCTGGCCCGAGGTCAGCGCGGCCGCCGGCGACGCGACGAGCACCGGGAGTCGG
TTCGACAGTGAGCTCTGGGCGTCCGTGGAGCAGCAGGACACCGGGACCCTCGCGGAAACC
CTGGGCGTCGACAGTGCGCTGGCCGCGTCGATGCTGCCGGCTCTGGCGTCGTGGCGTGAC
CGGCATCGCGACGCAGAGACCGTGAACGGCTGGCGCTACCGGGAAGCCTGGAAGCCGCTG
AACATCAGGTCGTCCTCCACCAAGGATCGTCGCTGGGCCGTGGTCGTTCCGGCGGGAGGG
AGCGACGACGCGCTCGTCGACGCCGTGACCGGTGCACTGGGAACCGATGTCACCGTGGTG
GAACACGACGGCATGCACACAGCGGAACACGGCAGCCACCCGCTGGGGGACAACGACGGC
ACCGCGATCGGATCCCGCTTCGACGGCATCCTGTTCCTTTCCGCTGTGGGGGGATCTGAC
CCGGCGACCATGCTGACCACCGTCACGGACCTCCTGTCCAAGATGCCGGACGACGGGGTT
CCGCTCTGGGTGGTGACGCGCGGCGCGGTCTCCGTCGGTGCGCAGGATCCGGTCACCGCG
CCCGGGCAGGCCGCAGTCTGGGGCCTCGGGCGCGTCGCCGCGCTGGAGCAACCCGCCGTC
TGGGGCGGCCTGATCGACCTGCCGGCCCAGCTCGACGCCCGCAGCGCCCGAGCGCTGGCC
GCCGTGCTCTCGGACGCTGCCGGCGAGGACCAGATCGCCATCCGCCCGGCCGGCACGTTC
GGCCGTCGGCTGACGCACGCCGCCGCGCCCGGCGGACCGGCGCCGTGGAAGACCTCGGGC
ACCGCCCTCATCACGGGCGGCACCGGCGGCCTGGGCGCCCACGTCGCCCGCTGGATCACC
GAGCGCGGCGCCGAGCATGTGGTCCTCGTCAGCAGGCGCGGCCCGGACGCGGACGGCGCG
GATCTGCTGCGCCTCGAGTTGGAGACCGCCGGCGCCCGGGTCACCGTCGCGGCCTGTGAC
GTCACCGACCGCGACGCGCTTGCCCAAGTGGTCTCGGAGATTCCCGAGGAGTGGCCGCTG
CGCACAGTGGTGCACGCCGCCGGTGTCATGGGCGATCCCACGCTCCTGACCGCGCTGACG
CCCCGCCTGCTCCGCCACCAGCTCGACCCGAAGGTCGACGGCGCCCGCCACCTCGACGAG
CTCACGCGCGACCTCGAGCTGGACGCCTTCGTGCTCTTCTCCTCCGGGGCGGGCGTCTGG
GGCGGCGGTGGCCAGGGCGCCTACGCGGCAGCCAATGCCTTCCTGGACGGCCTGGCCGCC
TGGCGCCGGAGTCACGGCCGCCCCGCGACGTCGGTGGCCTGGGGCTCCTGGGCCGAGGGC
GGCATGCTGGCCGACGCCGAAAGCGAGCACCGTGAGCGTTTGGGCCTGCTCGGCCTGGTC
CCCATGCGTCCCCACCTGGCACTGGCCGCCCTGCAGCGCGTCCTGCACGACGACGAGACC
GGTCTCGTGGTCACCGATCTGGACTGGGCCAGGTTTGCCCCGGTCTTCACGGCGGCCCGG
CCGAGCCCGTTGCTGTCCGATCTTCCCGAGGCAGCGGTCGCCCTGGTGCAGCCGGACGCC
GCGAGTACGGAGCGGCCGGCCCTACGGCTCGCCGGACTGTCCGCTGCCGAGCGTGAGGAG
GCCCTGCTCACCCTGGTACGGGAGGCGGTCGCGGCGGTTCTCGGGCACGCGCCCGGGACG
CAGGTCGACGACGAGCAGCCGTTCAAGGAGCTCGGCTTCGACTCGCTGACCGCGGTCGAG
CTGCGCAACGTCCTGCAGACCAGGACGGGGGTCGGCCTCGCCGCCGGGGTGGTGTTCGAC
CACCCGGATCCGCGCAGCCTGGCCAAGGCCCTGGCCGCGGCTCTCCGGCCGGCGGACCAC
GCCGAGCCGCAGGAGGCGCAGTCCGACTACTTCGGTGAGCTCTTCCTTCAGGCCATGCGG
ACCGGCGAGCTGGCGCAGGCCCAGCAGCTCATGGCCGGCGCTGCGCAACTGCGCCTCAAG
TACGGCGATCCGGCCGGACCGGAAGCCGTGCCCGAGATCGTGCGGCTGGGCCGGGGACAG
CTGGGCCCGCAGCTGATCCTCGTGTGCCCGACCGTCATGACAACCGGGCCGCAGGTCTAC
AGTCGGCTCGCGGAGGAGCTGGACGCCGGACGACGGGTATCGGCGCTGGTGCCGCCCGGG
TTCCACGGTGGCCAGGCGCTGCCCGCCACCCTGACGGTCCTGGTGCGCAGCCTGGCGGAC
GTGGTGCAGGCCGAGGTGGCGGACGGGGAGTTCGCGCTGGCCGGGCACTCCTCGGGCGGC
GTGGTGGCGTACGAGGTGGCCAGGGAGCTGGAGGCGCGCGGCCTGGCGCCGCGCGGGGTG
GTGCTGATCGACTCGTACAGCTTCGACGGCGACGGCGGGCGGCCAGAGGAGCTGTTCCGC
AGCGCGCTCAACGAGCGCTTCGTCGAGTATCTGCGCCTGACGGGCGGCGGCAACCTGTCC
CAGCGCATCACCGCCCAGGTCTGGTGCCTGGAACTGCTGCGTGGCTGGCGGCCGGAGGGG
CTCACCGCGCCCACCCTGTACGTACGCCCGGCGCAGCCCCTCGTGGAGCAGGAGAAGCCC
GAATGGCGCGGCGACGTCCTCGCGGCGATGGGGCAGGTGGTCGAGGCGCCCGGCGACCAC
TTCACGATCATCGAGGGCGAGCACGTCGCCTCGACCGCGCACATTGTCGGCGACTGGCTG
CGTGAGGCGCACGCACACTACTCGACTGAGGGATGGGGCGGCGGCCTCCGGACGGAAGAA
TGA
[6] KS78..453
[6] AT625..929
[6] methylmalonyl-CoA812..816
[6] DH977..1143
[6] ER1424..1726
[6] KR1736..1916
[6] ACP2016..2086
[7] KS2109..2483
[7] AT2632..2900
[7] malonyl-CoA2814..2818
[7] DH2978..3142
[7] ER3447..3750
[7] KR3760..3935
[7] ACP4028..4098
[8] KS4120..4496
[8] AT4646..4960
[8] ethylmalonyl-CoA not conserved XAGHS4832..4836
[8] DH5008..5166
[8] KR5460..5636
[8] ACP5733..5807
[9] KS5830..6205
[9] AT6358..6625
[9] malonyl-CoA6540..6544
[9] KR6960..7140
[9] ACP7242..7312
[9] TE7387..7600
[6] KS232..1359
[6] AT1873..2787
[6] methylmalonyl-CoA2434..2448
[6] DH2929..3429
[6] ER4270..5178
[6] KR5206..5748
[6] ACP6046..6258
[7] KS6325..7449
[7] AT7894..8700
[7] malonyl-CoA8440..8454
[7] DH8932..9426
[7] ER10339..11250
[7] KR11278..11805
[7] ACP12082..12294
[8] KS12358..13488
[8] AT13936..14880
[8] ethylmalonyl-CoA not conserved XAGHS14494..14508
[8] DH15022..15498
[8] KR16378..16908
[8] ACP17197..17421
[9] KS17488..18615
[9] AT19072..19875
[9] malonyl-CoA19618..19632
[9] KR20878..21420
[9] ACP21724..21936
[9] TE22159..22800

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001031 Thioesterase (Domain)
 [7387-7600]  1.8e-24 PF00975
PF00975   Thioesterase
IPR001227 Acyl transferase domain (Domain)
 [618-745]  G3DSA:3.40.366.10 [812-916]  G3DSA:3.40.366.10 [2622-2752]  G3DSA:3.40.366.10 [2814-2920]  G3DSA:3.40.366.10 [4637-4766]  G3DSA:3.40.366.10 [4832-4948]  G3DSA:3.40.366.10 [6348-6478]  G3DSA:3.40.366.10 [6540-6646]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR002364 Quinone oxidoreductase/zeta-crystallin, conserved site (Conserved_site)
 [1554-1575]  PS01162 [3575-3596]  PS01162
PS01162   QOR_ZETA_CRYSTAL
IPR006162 Phosphopantetheine attachment site (PTM)
 [2044-2059]  PS00012 [4056-4071]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [2016-2086]  PS50075 [4028-4098]  PS50075 [5733-5807]  PS50075 [7242-7312]  PS50075
PS50075   ACP_DOMAIN
 [2009-2125]  1.10000150671642e-27 SSF47336 [4021-4136]  1.70000295590054e-29 SSF47336 [5730-5846]  5.20000089003336e-26 SSF47336 [7234-7329]  8.70001261213513e-21 SSF47336
SSF47336   ACP_like
 [2019-2085]  1.7e-13 PF00550 [4031-4097]  1.9e-13 PF00550 [5744-5806]  3.60000000000001e-12 PF00550 [7246-7310]  3.3e-12 PF00550
PF00550   PP-binding
 [2014-2087]  3.99999999999998e-85 G3DSA:1.10.1200.10 [4027-4101]  3.99999999999998e-85 G3DSA:1.10.1200.10 [5735-5808]  3.99999999999998e-85 G3DSA:1.10.1200.10 [7240-7316]  3.99999999999998e-85 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
IPR011032 GroES-like (Domain)
 [1415-1572]  9.30000048475975e-30 SSF50129 [3436-3584]  2.30000440726534e-29 SSF50129
SSF50129   GroES_like
IPR013149 Alcohol dehydrogenase, C-terminal (Domain)
 [3586-3677]  1e-17 PF00107
PF00107   ADH_zinc_N
IPR013154 Alcohol dehydrogenase GroES-like (Domain)
 [1444-1502]  1.1e-06 PF08240 [3467-3523]  4.6e-06 PF08240
PF08240   ADH_N
IPR013968 Polyketide synthase, KR (Domain)
 [1736-1914]  2.29999999999998e-63 PF08659 [3760-3933]  9.8e-58 PF08659 [5460-5634]  2.1e-60 PF08659 [6960-7139]  1.09999999999999e-63 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [78-327]  5.00000000000001e-86 PF00109 [2109-2357]  1.60000000000002e-86 PF00109 [4120-4370]  2.50000000000001e-85 PF00109 [5830-6079]  5.20000000000001e-85 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [336-453]  1e-46 PF02801 [2365-2483]  1.2e-46 PF02801 [4378-4496]  3.8e-46 PF02801 [6087-6205]  2.59999999999998e-46 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [625-929]  3.60000000000002e-96 PF00698 [2632-2900]  1.6e-53 PF00698 [4646-4960]  3.99999999999998e-88 PF00698 [6358-6625]  1.2e-53 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [623-918]  2.39999798157265e-62 SSF52151 [2627-2929]  3.89999861795218e-69 SSF52151 [4644-4944]  2.60000517657733e-60 SSF52151 [6353-6655]  3.39999972437719e-69 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [747-811]  4.80000830876748e-17 SSF55048 [2754-2813]  2.2999993566538e-11 SSF55048 [4769-4831]  4.70000326671386e-12 SSF55048 [6480-6539]  2.2999993566538e-11 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [78-338]  G3DSA:3.40.47.10 [341-504]  G3DSA:3.40.47.10 [2109-2368]  G3DSA:3.40.47.10 [2371-2533]  G3DSA:3.40.47.10 [4119-4380]  G3DSA:3.40.47.10 [4384-4546]  G3DSA:3.40.47.10 [5829-6090]  G3DSA:3.40.47.10 [6093-6255]  G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [70-451]  1.39999277195148e-97 SSF53901 [2108-2481]  4.40002866058555e-97 SSF53901 [4112-4494]  1.69998802370953e-97 SSF53901 [5822-6203]  5.60004908290974e-98 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1562-1650]  3.29999999999997e-33 G3DSA:3.40.50.720 [1735-1951]  G3DSA:3.40.50.720 [3583-3677]  3.29999999999997e-33 G3DSA:3.40.50.720 [3760-3941]  G3DSA:3.40.50.720 [5461-5642]  G3DSA:3.40.50.720 [6960-7142]  G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [240-256]  PS00606 [2270-2286]  PS00606 [4283-4299]  PS00606 [5992-6008]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [627-910]  1.3000049540733e-117 SM00827 [2632-2911]  8.19994104549874e-113 SM00827 [4648-4941]  1.50000965748778e-96 SM00827 [6358-6637]  2.19999900980707e-112 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [2017-2089]  2.19999900980708e-31 SM00823 [4029-4101]  1.89999859865865e-32 SM00823 [5738-5810]  7.30000590915208e-30 SM00823 [7243-7315]  6.30000946287306e-29 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [977-1143]  2.1000026783403e-75 SM00826 [2978-3142]  5.6999970878395e-74 SM00826 [5008-5166]  1.39999277195148e-76 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [80-505]  SM00825 [2111-2535]  SM00825 [4122-4548]  SM00825 [5832-6257]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1736-1916]  3.89999861795218e-64 SM00822 [3760-3935]  7.6999848053369e-54 SM00822 [5460-5636]  9.00000407957278e-59 SM00822 [6960-7140]  1.20000117458134e-60 SM00822
SM00822   PKS_KR
IPR020843 Polyketide synthase, enoylreductase (Domain)
 [1424-1726]  SM00829 [3447-3750]  SM00829
SM00829   PKS_ER
SignalP
 [1-33]  0.487 Signal
Bacteria, Gram-positive   
TMHMM No significant hit