close all open/close all

CDS information : Tatmc_00100


close this sectionLocation

Organism
StrainCK4412
Entry nameTautomycetin
Contig
Start / Stop / Direction60,951 / 61,616 / + [in whole cluster]
60,951 / 61,616 / + [in contig]
Location60951..61616 [in whole cluster]
60951..61616 [in contig]
TypeCDS
Length666 bp (221 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative decarboxylase
Product (GenBank)TMC biosynthetic enzyme R1
Gene
Gene (GenBank)tmcJ
EC number4.1.1.-
Keyword
Note
Note (GenBank)
  • decarboxylase; ORF R1
Reference
ACC
PmId
[17379718] Isolation of the biosynthetic gene cluster for tautomycetin, a linear polyketide T cell-specific immunomodulator from Streptomyces sp. CK4412. (Microbiology. , 2007)
Related Reference
ACC
C6ZCR9
PmId
[19191560] Characterization of the tautomycetin biosynthetic gene cluster from Streptomyces griseochromogenes provides new insight into dialkylmaleic anhydride biosynthesis. (J Nat Prod. , 2009)
[22339318] Functional characterization of ttnI completing the tailoring steps for tautomycetin biosynthesis in Streptomyces griseochromogenes. (Org Lett. , 2012)
ACC
P33751
PmId
[8181743] PAD1 encodes phenylacrylic acid decarboxylase which confers resistance to cinnamic acid in Saccharomyces cerevisiae. (Gene. , 1994)

close this sectionSequence

selected fasta
>putative decarboxylase [TMC biosynthetic enzyme R1]
MGRRPPDGRMTGMRLIVAITGATGAALGVRLLQRLRAVGSVETHLVLSRWSRPTIELETP
FTVAQVRDLADVSYGSADQAAAISSGSFRAAGMVVIPCTMKTLAAIRAGYADDLVTRAAD
VVIKERRRLVLVTRETPLSPIHLENMLELARIGITIMPPMPAYYARPHDLDDVADNFVGR
VLDQFGLETDVVHRWGGLHVSPSGIPVHKLTDEGFLKGTGE
selected fasta
>putative decarboxylase [TMC biosynthetic enzyme R1]
ATGGGGCGGCGGCCTCCGGACGGAAGAATGACCGGCATGCGATTGATCGTTGCCATCACC
GGCGCCACCGGTGCCGCGCTGGGCGTCCGCCTGCTCCAGAGGCTGCGGGCGGTCGGCTCG
GTCGAGACCCATCTCGTGCTGAGCCGGTGGTCGAGGCCCACGATCGAGCTGGAGACGCCG
TTCACCGTGGCGCAGGTACGCGACCTCGCCGACGTGAGCTACGGGTCGGCGGACCAGGCC
GCCGCGATCTCGAGCGGCTCCTTCCGTGCGGCGGGAATGGTTGTGATCCCCTGCACCATG
AAGACGCTCGCGGCGATCCGGGCCGGCTACGCGGACGACCTCGTCACCCGGGCGGCCGAC
GTGGTCATCAAGGAGCGGCGGCGTCTCGTGCTGGTGACGCGGGAGACGCCGCTGTCCCCG
ATCCACCTGGAGAACATGCTCGAGCTGGCCCGCATCGGCATCACGATCATGCCGCCGATG
CCCGCCTACTACGCCCGCCCGCACGACCTCGACGACGTCGCGGACAACTTCGTCGGCCGG
GTCCTCGACCAGTTCGGGCTGGAGACCGACGTCGTGCACCGCTGGGGTGGCCTGCACGTG
AGTCCGTCCGGCATCCCGGTGCACAAGCTGACCGACGAGGGCTTCCTGAAGGGAACAGGT
GAATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003382 Flavoprotein (Domain)
 [13-142]  4.29999999999999e-25 PF02441
PF02441   Flavoprotein
 [13-198]  2.50000909916183e-61 SSF52507
SSF52507   Flavoprotein
 [13-188]  9.9e-75 G3DSA:3.40.50.1950
G3DSA:3.40.50.1950   Flavoprotein
IPR004507 Phenylacrylic acid decarboxylase (Family)
 [14-195]  1.5e-75 TIGR00421
TIGR00421   UbiX_pad
SignalP
 [1-28]  0.561 Signal
Eukaryota   
TMHMM
 [10-32]  Transmembrane (o-i)
Transmembrane 1