close all open/close all

CDS information : Tatmc_00110


close this sectionLocation

Organism
StrainCK4412
Entry nameTautomycetin
Contig
Start / Stop / Direction61,613 / 63,070 / + [in whole cluster]
61,613 / 63,070 / + [in contig]
Location61613..63070 [in whole cluster]
61613..63070 [in contig]
TypeCDS
Length1,458 bp (485 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative decarboxylase
Product (GenBank)TMC biosynthetic enzyme R2
Gene
Gene (GenBank)tmcK
EC number4.1.1.-
Keyword
  • C-3''
Note
Note (GenBank)
  • decarboxylase; ORF R2
Reference
ACC
PmId
[17379718] Isolation of the biosynthetic gene cluster for tautomycetin, a linear polyketide T cell-specific immunomodulator from Streptomyces sp. CK4412. (Microbiology. , 2007)
Related Reference
ACC
C6ZCR8
PmId
[19191560] Characterization of the tautomycetin biosynthetic gene cluster from Streptomyces griseochromogenes provides new insight into dialkylmaleic anhydride biosynthesis. (J Nat Prod. , 2009)
[20426415] Functional characterization of TtnD and TtnF, unveiling new insights into tautomycetin biosynthesis. (J Am Chem Soc. , 2010)
[22339318] Functional characterization of ttnI completing the tailoring steps for tautomycetin biosynthesis in Streptomyces griseochromogenes. (Org Lett. , 2012)
ACC
P0AAB4
PmId
[782527] Membrane-associated reactions in ubiquinone biosynthesis in Escherichia coli. 3-Octaprenyl-4-hydroxybenzoate carboxy-lyase. (Biochim Biophys Acta. , 1976)
[11029449] Identification of the ubiD gene on the Escherichia coli chromosome. (J Bacteriol. , 2000)

close this sectionSequence

selected fasta
>putative decarboxylase [TMC biosynthetic enzyme R2]
MKRLKDLREYLAVLEAHQDVREIDEPVDPHLEAGAAARWTYENRGPALMLNDLTGTGRFC
RILAAPAGLSTIPGSPLARVALSLGLDVSATAHEIVDSLAAARTREPVAPVVVDSAPCQD
NVLLGDDANLDRFPAPLLHEGDGGPYLNTWGTIIVSTPDGSFTNWAIARVMKIDGKRMTG
TFIPTQHLGQIRKLWDNLGQPMPFAIVQGTEPGIPFVASMPLPDGIEEVGFLGAYFGEPL
ELVRAKTVDLLVPASAEIVIEGHVMPGRTAVEGPMGEYAGYQPRHTSMQPEYVVDAITYR
DDPIWPISVAGEPVDETHTAWGLVTAAEALALLRAAKLPVATAWMPFEAAAHWLIVCLTE
DWRERMPGLSRDGICLRISQVLAATRIEAMMTRVFVLDDDVDPSDQTELAWAIATRVSPA
HGRLVRHGMINPLAGCYSAEERRLGYGPKAVLNGLLPPMAERSRRSSFRHTYPEPVRQRV
IELLA
selected fasta
>putative decarboxylase [TMC biosynthetic enzyme R2]
ATGAAGCGACTCAAGGATCTCCGCGAGTACCTGGCGGTGCTGGAGGCGCACCAGGACGTC
CGGGAGATCGACGAGCCCGTGGACCCGCACCTGGAGGCCGGGGCGGCCGCCCGCTGGACG
TACGAGAATCGCGGTCCGGCCCTGATGTTGAACGACCTGACCGGGACCGGCCGGTTCTGC
CGGATCCTGGCCGCGCCCGCCGGGCTCAGCACCATCCCCGGGTCCCCGCTGGCGCGCGTC
GCGCTCTCGCTCGGGCTGGACGTCTCCGCCACAGCGCACGAGATCGTGGACTCCCTGGCG
GCCGCCCGTACCCGTGAGCCGGTCGCGCCGGTCGTCGTGGACTCGGCGCCGTGTCAGGAC
AACGTGCTGCTCGGCGACGACGCGAACCTCGACCGCTTCCCGGCGCCGCTGCTGCACGAG
GGCGACGGCGGGCCTTATCTCAACACCTGGGGCACGATCATAGTCTCGACCCCCGACGGG
TCGTTCACCAACTGGGCCATCGCCCGGGTGATGAAGATCGACGGCAAACGGATGACGGGT
ACGTTCATCCCGACGCAACACCTCGGGCAGATCCGCAAGTTGTGGGACAACCTCGGGCAG
CCGATGCCGTTCGCCATCGTCCAGGGCACCGAGCCGGGCATCCCGTTCGTCGCGAGCATG
CCGTTGCCCGACGGGATTGAGGAGGTGGGCTTCCTGGGTGCGTACTTCGGCGAGCCGCTG
GAGCTGGTCCGGGCGAAGACCGTCGACCTGCTGGTGCCCGCGAGTGCCGAGATCGTCATC
GAGGGGCACGTCATGCCCGGCCGCACGGCGGTCGAGGGGCCGATGGGTGAGTACGCCGGC
TACCAGCCGCGCCACACCAGCATGCAACCGGAGTACGTGGTCGACGCGATCACCTACCGC
GACGACCCGATCTGGCCCATTTCGGTCGCTGGGGAGCCGGTCGACGAGACACACACCGCG
TGGGGCCTGGTCACGGCGGCCGAGGCGCTGGCCCTGCTGCGCGCCGCGAAGCTGCCAGTC
GCCACGGCGTGGATGCCCTTCGAGGCCGCCGCCCACTGGCTGATCGTGTGTCTTACCGAG
GACTGGCGTGAGCGGATGCCCGGGCTGAGCCGTGACGGCATCTGCTTGCGCATCTCGCAG
GTCCTCGCCGCCACCCGCATCGAGGCCATGATGACGCGCGTCTTCGTGCTCGACGACGAC
GTCGACCCGTCGGACCAGACCGAGCTGGCCTGGGCCATCGCGACCCGGGTGAGTCCCGCA
CACGGTCGCTTGGTCCGTCACGGCATGATCAACCCGCTCGCGGGCTGCTACTCCGCCGAG
GAGCGGCGGCTCGGCTACGGGCCCAAGGCCGTCCTCAACGGGCTCCTGCCGCCGATGGCC
GAGCGCAGCCGGCGCAGTTCCTTCCGCCACACCTACCCCGAGCCGGTGCGGCAGCGGGTC
ATCGAGCTCCTTGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002830 Carboxylyase-related (Family)
 [11-426]  1.2e-116 PF01977
PF01977   UbiD
 [7-425]  7.7e-84 TIGR00148
TIGR00148   TIGR00148: UbiD family decarboxylases
IPR009002 FMN-binding split barrel-related (Domain)
 [4-313]  1.6e-88 SSF50475
SSF50475   FMN-binding split barrel
SignalP No significant hit
TMHMM No significant hit