close all open/close all

CDS information : Tatmc_00120


close this sectionLocation

Organism
StrainCK4412
Entry nameTautomycetin
Contig
Start / Stop / Direction63,086 / 64,432 / + [in whole cluster]
63,086 / 64,432 / + [in contig]
Location63086..64432 [in whole cluster]
63086..64432 [in contig]
TypeCDS
Length1,347 bp (448 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative crotonyl-CoA reductase
Product (GenBank)TMC biosynthetic enzyme R3
Gene
Gene (GenBank)tmcL
EC number1.3.1.-
Keyword
  • ethylmalonyl-CoA
Note
Note (GenBank)
  • crotonyl CoA reductase; ORF R3
Reference
ACC
PmId
[17379718] Isolation of the biosynthetic gene cluster for tautomycetin, a linear polyketide T cell-specific immunomodulator from Streptomyces sp. CK4412. (Microbiology. , 2007)
Related Reference
ACC
C6ZCR7
PmId
[19191560] Characterization of the tautomycetin biosynthetic gene cluster from Streptomyces griseochromogenes provides new insight into dialkylmaleic anhydride biosynthesis. (J Nat Prod. , 2009)
ACC
Q53865
PmId
[8521864] Purification of crotonyl-CoA reductase from Streptomyces collinus and cloning, sequencing and expression of the corresponding gene in Escherichia coli. (Eur J Biochem. , 1995)

close this sectionSequence

selected fasta
>putative crotonyl-CoA reductase [TMC biosynthetic enzyme R3]
MRSSMDEIRQAIVHGDYAAAASLPVPESYRAVTVHADETDMFEDMAPADRDPRKSLHVDE
VPTPELGPGEALVAVMASAINYNTVWTSIFEPIPTFTFLRRYGRSNPLAKRHDLPYHVVG
SDLSGVVLRTGPGVHVWRPGDEVVAHCLSVELEGPDGHNDAMLDSEQRIWGFETNFGGLA
EIALVKATQLMPKPPHLTWEEAASLGLVNSTAYRQLVSRNGADLKQGDTVLIWGASGGLG
SYATQYALNGGAIPVCVVSSPDKAEVCRAMGAEYVIDRSADGYRFWKDDHTQDPKEWRRF
GTRIRELTGGDDPDIVFEHPGRETFGASVYVARRGGTIVTCASTSGYEHQFDNRYLWMNL
KRVIGTHFANYREAWEANRLVAKAQIHPTLSTTYPLEQTGHAVLDLHRNVHQGKVGVRVL
APAEGLGVHDHELRERHLKSINRFRSTP
selected fasta
>putative crotonyl-CoA reductase [TMC biosynthetic enzyme R3]
GTGAGGTCATCCATGGACGAGATCCGTCAGGCGATCGTGCACGGGGACTACGCGGCGGCG
GCGAGCCTGCCGGTGCCGGAGTCCTACCGCGCCGTGACCGTGCATGCGGACGAGACCGAC
ATGTTCGAGGACATGGCGCCGGCCGACCGTGACCCGCGCAAGTCCCTGCACGTCGACGAG
GTGCCCACCCCGGAGCTGGGCCCGGGAGAGGCCCTGGTCGCGGTGATGGCGAGCGCCATC
AACTACAACACCGTGTGGACCTCGATCTTCGAGCCGATCCCCACCTTCACCTTCCTGCGC
CGCTACGGCCGGTCCAACCCGCTGGCCAAGCGGCACGACCTGCCCTATCACGTCGTCGGC
TCGGACCTGTCGGGCGTGGTGCTGCGCACCGGCCCCGGCGTGCATGTGTGGCGGCCGGGG
GACGAGGTGGTCGCGCACTGCCTCAGCGTCGAGCTGGAGGGCCCGGACGGCCACAACGAC
GCGATGCTCGACAGCGAGCAGCGGATCTGGGGCTTCGAGACCAACTTCGGCGGTCTGGCC
GAGATCGCCTTGGTCAAGGCGACCCAGCTCATGCCCAAGCCGCCCCACCTGACCTGGGAG
GAGGCGGCCTCACTGGGGCTGGTCAACTCCACCGCCTATCGCCAACTCGTCTCCCGCAAC
GGCGCGGACCTGAAGCAAGGCGACACCGTGCTGATCTGGGGCGCCTCCGGCGGTCTCGGC
TCGTACGCCACCCAGTACGCACTCAACGGCGGCGCCATCCCGGTGTGCGTCGTGTCCAGC
CCGGACAAGGCGGAGGTGTGCCGGGCGATGGGCGCGGAGTACGTCATCGACCGCAGCGCG
GACGGCTACCGCTTCTGGAAGGACGACCACACGCAGGACCCGAAGGAGTGGCGTCGCTTC
GGTACCCGGATCCGCGAGCTGACCGGAGGCGACGACCCGGACATCGTATTCGAGCACCCG
GGCCGGGAGACCTTCGGCGCCTCCGTCTACGTGGCCCGCCGCGGAGGCACGATCGTCACC
TGCGCGTCGACCTCGGGCTATGAACACCAGTTCGACAATCGCTATCTGTGGATGAACCTC
AAGCGCGTCATCGGGACGCACTTCGCCAACTACCGCGAGGCATGGGAAGCCAACCGGCTC
GTCGCGAAGGCGCAGATCCACCCGACGCTGTCCACGACATATCCGCTGGAGCAGACCGGC
CACGCGGTCCTCGACCTGCACCGCAACGTGCATCAGGGCAAGGTGGGCGTCCGCGTGCTG
GCCCCTGCGGAGGGCCTGGGCGTCCACGACCACGAGCTGCGGGAGCGGCACCTGAAGTCC
ATCAACCGGTTCCGCAGCACCCCCTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR010085 Crotonyl-CoA reductase (Family)
 [33-429]  TIGR01751
TIGR01751   Crot-CoA-red
IPR011032 GroES-like (Domain)
 [45-245]  9.30000048475975e-29 SSF50129
SSF50129   GroES_like
IPR013149 Alcohol dehydrogenase, C-terminal (Domain)
 [238-382]  1.5e-37 PF00107
PF00107   ADH_zinc_N
IPR013154 Alcohol dehydrogenase GroES-like (Domain)
 [115-192]  4.1e-05 PF08240
PF08240   ADH_N
IPR016040 NAD(P)-binding domain (Domain)
 [233-365]  1.69999999999999e-22 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP No significant hit
TMHMM No significant hit