close all open/close all

CDS information : Tatmc_00130


close this sectionLocation

Organism
StrainCK4412
Entry nameTautomycetin
Contig
Start / Stop / Direction66,930 / 65,380 / - [in whole cluster]
66,930 / 65,380 / - [in contig]
Locationcomplement(65380..66930) [in whole cluster]
complement(65380..66930) [in contig]
TypeCDS
Length1,551 bp (516 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative dehydratase
Product (GenBank)TMC biosynthetic enzyme R4
Gene
Gene (GenBank)tmcM
EC number
Keyword
  • C-1''/C-2''
Note
Note (GenBank)
  • acyl-CoA transferases/carnitine dehydratase; ORF R4
Reference
ACC
PmId
[17379718] Isolation of the biosynthetic gene cluster for tautomycetin, a linear polyketide T cell-specific immunomodulator from Streptomyces sp. CK4412. (Microbiology. , 2007)
Related Reference
ACC
C6ZCR6
PmId
[19191560] Characterization of the tautomycetin biosynthetic gene cluster from Streptomyces griseochromogenes provides new insight into dialkylmaleic anhydride biosynthesis. (J Nat Prod. , 2009)
[20426415] Functional characterization of TtnD and TtnF, unveiling new insights into tautomycetin biosynthesis. (J Am Chem Soc. , 2010)
[22339318] Functional characterization of ttnI completing the tailoring steps for tautomycetin biosynthesis in Streptomyces griseochromogenes. (Org Lett. , 2012)

close this sectionSequence

selected fasta
>putative dehydratase [TMC biosynthetic enzyme R4]
MFPPLESENGTVTSTRSETDLTGRVAAAVSSPATHDDFDPHAALTEVLAGIGISPADSGG
RIGFAGADPVVPSTLRLGGASAIALATKAVAVAKLWRLRGGQSQDIAVDLRVTPHRLCPF
YDGRWEKINGHLLGSPANAGSAAFAFGFYRTADDRWVMPLNPYPKIKVAAQKLLGVPDDV
ASVRAAVARWPGRELEEAAAEAGCVLPMLRTTAELLAEPHYRDHLARLPLVTVERIGDSA
PEPLPPGVPDPLTGVRALGMGHVIAGAGTGRALALHGADVLNVWHPMQLEHPVTYATANV
GVRSTTLNPRAADDAATLRRLLAGADVFYANRRPGHLDRIGLSAEQAAAERPGIVHVTAS
LNGPDGPWAGRVGFDQSAGSLTGMMHLEGGLGGTGTEPALPPILVVNDYIVAWLMAAGAI
EALCRRAVLGGSYRVHVSLTRTALWILGLGIFDRDYAHATAGRGPEHAYHDPELFTAETP
LGHYQGVTEQVRMSATPGRYRTVLVPRGSSRPEWID
selected fasta
>putative dehydratase [TMC biosynthetic enzyme R4]
GTGTTCCCACCCCTTGAATCGGAGAACGGCACGGTGACGAGCACACGAAGCGAGACGGAT
CTGACCGGCCGGGTCGCAGCCGCGGTGTCCAGCCCGGCGACCCACGACGACTTCGACCCG
CACGCGGCGCTGACCGAGGTGCTGGCCGGGATCGGGATCAGCCCGGCGGACAGCGGCGGG
CGGATCGGCTTCGCCGGGGCGGATCCCGTGGTGCCCAGCACGCTGCGCCTGGGTGGTGCC
TCGGCGATCGCCCTGGCCACCAAGGCAGTGGCGGTGGCCAAGCTGTGGCGGCTGCGCGGC
GGGCAGAGCCAGGACATCGCGGTCGACCTGCGAGTCACCCCGCATCGCCTGTGCCCCTTC
TACGACGGGCGCTGGGAGAAGATCAACGGTCACCTGCTCGGGTCGCCTGCGAACGCGGGC
AGCGCGGCCTTCGCGTTCGGCTTCTACCGCACGGCCGACGACCGCTGGGTGATGCCACTC
AACCCGTACCCGAAGATCAAGGTCGCCGCCCAGAAGCTGCTCGGCGTGCCGGACGACGTG
GCGTCCGTGCGGGCCGCCGTCGCCCGCTGGCCCGGCCGGGAACTGGAGGAGGCGGCCGCC
GAGGCCGGTTGCGTGCTGCCGATGCTGCGCACCACCGCCGAGCTGCTCGCGGAGCCGCAC
TACCGCGACCACCTGGCGCGCCTGCCGCTGGTCACCGTTGAGCGCATCGGCGACTCCGCA
CCCGAGCCGCTGCCGCCCGGCGTACCGGACCCGCTGACCGGCGTACGGGCGCTGGGCATG
GGCCACGTCATCGCCGGCGCCGGGACCGGGCGGGCGCTCGCCCTGCACGGCGCGGACGTG
CTCAACGTGTGGCACCCGATGCAGCTGGAGCACCCGGTCACCTACGCCACGGCGAACGTG
GGCGTGCGTTCCACCACGCTGAACCCCCGCGCGGCCGACGACGCGGCGACCCTGCGCAGG
TTGCTGGCGGGAGCAGATGTCTTCTACGCCAACCGCCGCCCCGGCCACCTCGACCGCATC
GGGCTGTCGGCGGAGCAGGCGGCGGCCGAGCGACCCGGGATCGTGCACGTCACCGCCTCG
CTCAACGGGCCGGACGGGCCGTGGGCCGGGCGCGTCGGCTTCGACCAGAGCGCGGGCAGC
CTGACCGGCATGATGCACCTGGAGGGCGGCCTGGGCGGGACGGGTACGGAACCCGCCCTC
CCGCCGATTCTCGTGGTCAACGACTACATTGTCGCGTGGCTGATGGCCGCGGGGGCGATC
GAGGCTCTGTGCCGACGGGCTGTGCTCGGGGGCAGCTACCGCGTCCACGTGTCGCTGACC
CGGACCGCGCTGTGGATCCTCGGACTAGGCATCTTCGACCGCGACTACGCCCACGCCACC
GCCGGCCGCGGCCCCGAGCACGCCTACCACGACCCAGAGCTGTTCACCGCCGAGACCCCC
CTCGGGCACTATCAGGGCGTCACCGAGCAGGTCCGCATGTCCGCCACGCCCGGCCGCTAC
CGCACGGTCCTCGTGCCGCGGGGCTCGAGCCGCCCGGAGTGGATCGACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003673 CoA-transferase family III (Family)
 [306-463]  9e-32 PF02515
PF02515   CoA_transf_3
IPR023606 CoA-transferase family III domain (Domain)
 [62-204]  2.80000000000001e-52 G3DSA:3.40.50.10540 [246-467]  2.80000000000001e-52 G3DSA:3.40.50.10540
G3DSA:3.40.50.10540   CoA-Trfase_fam_III
 [62-246]  3.29999802154459e-16 SSF89796 [248-485]  1.49999648196323e-42 SSF89796
SSF89796   CoA-Trfase_fam_III
SignalP No significant hit
TMHMM No significant hit