close all open/close all
Tatmc_00130 Tatmc_00130   last last

CDS information : Tatmc_00140


close this sectionLocation

Organism
StrainCK4412
Entry nameTautomycetin
Contig
Start / Stop / Direction70,003 / 66,914 / - [in whole cluster]
70,003 / 66,914 / - [in contig]
Locationcomplement(66914..70003) [in whole cluster]
complement(66914..70003) [in contig]
TypeCDS
Length3,090 bp (1,029 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
ProductLuxR family transcriptional activator
Product (GenBank)TMC biosynthetic enzyme R5
Gene
Gene (GenBank)tmcN
EC number
Keyword
Note
Note (GenBank)
  • regulatory protein LuxR; ORF R5
Reference
ACC
PmId
[17379718] Isolation of the biosynthetic gene cluster for tautomycetin, a linear polyketide T cell-specific immunomodulator from Streptomyces sp. CK4412. (Microbiology. , 2007)
[18832298] Identification of TmcN as a pathway-specific positive regulator of tautomycetin biosynthesis in Streptomyces sp. CK4412. (Microbiology. , 2008)
[19408025] Functional expression of SCO7832 stimulates tautomycetin production via pathway-specific regulatory gene overexpression in Streptomyces sp. CK4412. (J Ind Microbiol Biotechnol. , 2009)
Related Reference
ACC
C6ZCR5
PmId
[19191560] Characterization of the tautomycetin biosynthetic gene cluster from Streptomyces griseochromogenes provides new insight into dialkylmaleic anhydride biosynthesis. (J Nat Prod. , 2009)
[27444385] TmcN is involved in ATP regulation of tautomycetin biosynthesis in Streptomyces griseochromogenes. (Biochem Biophys Res Commun. , 2016)
Family/Domain
FD
IPR000792

close this sectionSequence

selected fasta
>LuxR family transcriptional activator [TMC biosynthetic enzyme R5]
MGDHAGRDPEEFDGGRMQQARTGHRRSGISAAQPCDRHQPWWPLRSTRVALEYPAGSARQ
DIASSSGCGRRSSVGISRCSSGGRETLHECGSISPRLSREFGSVTGSPGVGHFDDDLLGR
DDTQRMVDLFLGDGASHGGALIFSGPTGIGKTALLEYGIARAQARGLVVLRVAGTAGHVA
GSGLTELLGLLLEVVAGDPAQEKRFANAVQHCQDSERVKLSKLVSTVRAVLRQTRATSLL
IASDDLDRMDPTSYQALSMLAARLDGTGTRMIGTVHAGAGRYGPATHQLEPLHEDAAYAL
LERHFPLLSGRVRRRIVAEAEGNPLALRELPLPLTRTQSEVAAALPTILPLTERLQEIYR
PQVSSLSAGARDVLLAAALEGTGDLITLEALAGETLEAAVRDAEEARLARVDDTGNRLVF
RHPLARATVVALASPAERREAHRRLAQALADRPELHAWHLSQSVIATDSTTAKLVHDAAV
KAMSRGAVVSAVRLMTRAADLSADPRQRARRFGYAAAISVDATGDLTAVSRLLRDARESD
PDFDDTLPAIVTAAKTFLLSEGDADTASGLLVSALRARSEERMESVILLKSALWTLLRVC
RLSGRPELWDVFLRLIDEYRRHLTTFEVTVWQAAADPARADVARLAVVDREIASAMTDKD
HNRIIRLAEACAPVDRLGEMRAALWRVAQSGRNGLQPTTHAIRALNFLCADALTHGRWSD
VDTLSEEITRLCEGNSQRALFWLTEGSVAILAALRGDTERARALTREMVAWAVPRDARVV
LLLAAHARMLDALGAADFEAAYQYVAEAGLPDLTKSSSIEHMQMSFDIVLATVHTERHRE
AERYVRAMQASEMASLSPRLALQTAACAALVAPRAKAARNYETALALPGVNRLPYDRARV
QLAYGEHLRRVRATNEARRHLRTALNSFHDLGAQRWAARAKAELRAAGDRDTAAEPAESA
ALTPQELAIVRLAANGLTNKQIGKRLFLSPRTVANHLYRAFPKLDITSRASLRDALASLQ
LEDTGVPTP
selected fasta
>LuxR family transcriptional activator [TMC biosynthetic enzyme R5]
GTGGGTGATCATGCAGGACGAGACCCGGAGGAGTTCGACGGGGGTCGAATGCAACAGGCT
CGCACCGGCCACCGACGATCCGGCATATCCGCAGCTCAACCCTGTGATCGGCACCAACCA
TGGTGGCCTCTGCGGTCCACGCGAGTTGCCCTGGAGTACCCGGCAGGGAGTGCACGTCAG
GACATTGCGTCAAGCTCCGGCTGTGGGCGACGATCTTCCGTAGGCATCAGCCGGTGCTCA
TCTGGAGGTCGTGAAACGTTGCACGAATGCGGCAGCATCTCCCCACGGTTATCAAGAGAG
TTCGGCTCAGTGACCGGATCGCCCGGCGTCGGCCACTTCGACGATGATCTGCTGGGCCGC
GACGATACGCAGCGCATGGTGGATCTTTTCCTCGGCGACGGCGCGAGCCACGGCGGCGCC
CTGATCTTCTCCGGCCCGACCGGCATCGGGAAGACCGCACTGCTGGAGTACGGGATCGCC
CGTGCCCAGGCTCGCGGCCTGGTCGTGCTGCGCGTGGCCGGCACCGCCGGGCACGTGGCC
GGTTCCGGCCTGACCGAACTGCTGGGCCTGCTGCTCGAGGTCGTCGCGGGCGATCCGGCT
CAGGAAAAGCGCTTCGCCAACGCCGTGCAGCACTGCCAGGACAGCGAGCGGGTAAAACTG
TCCAAGCTGGTCAGCACGGTCCGCGCCGTTCTGCGCCAAACGCGCGCGACCAGCCTGCTC
ATCGCCTCCGACGACCTGGACCGGATGGACCCCACCAGCTACCAGGCGCTGAGCATGCTC
GCCGCCCGGCTGGACGGCACGGGAACACGGATGATCGGCACGGTGCACGCCGGGGCCGGG
CGGTACGGGCCGGCGACGCACCAGCTCGAACCGCTGCATGAGGACGCCGCGTACGCCCTG
CTGGAGCGGCACTTCCCGCTCCTGTCCGGGCGGGTGCGCCGACGGATCGTGGCGGAGGCC
GAAGGCAATCCGCTGGCCCTGCGCGAGCTGCCCCTTCCGCTGACCCGCACGCAGAGCGAG
GTGGCCGCCGCCCTGCCGACGATCCTGCCGCTGACCGAGCGCCTGCAGGAGATCTACCGC
CCGCAGGTGTCGTCGCTGTCGGCCGGCGCCCGCGACGTGCTCCTCGCCGCCGCCCTCGAG
GGGACCGGGGACCTCATCACGCTCGAGGCGTTAGCCGGGGAAACGCTCGAAGCCGCCGTC
CGAGATGCCGAGGAGGCCCGGCTCGCCCGGGTGGACGACACAGGCAACCGGCTCGTCTTC
CGGCACCCGCTCGCCCGGGCGACCGTCGTCGCGCTCGCCTCACCCGCTGAGCGCCGCGAG
GCGCACCGCCGCCTGGCCCAGGCGCTCGCCGACCGGCCTGAGCTGCACGCCTGGCACCTG
TCCCAGTCCGTCATCGCCACCGACAGCACGACCGCGAAGCTGGTGCACGACGCGGCCGTG
AAGGCGATGAGCCGCGGGGCGGTCGTCAGCGCCGTACGGCTGATGACACGAGCCGCTGAC
CTGAGCGCCGACCCTCGGCAGCGGGCTCGCCGGTTCGGCTACGCGGCGGCGATAAGCGTA
GACGCGACGGGTGACCTCACTGCCGTGTCCCGGCTGCTACGGGACGCCCGCGAGAGCGAC
CCGGACTTCGACGACACCTTGCCGGCGATCGTGACGGCGGCCAAGACGTTCCTGCTCAGC
GAGGGGGACGCCGACACCGCCTCCGGCCTGCTGGTCTCGGCCCTGCGGGCGCGCAGCGAG
GAACGGATGGAAAGCGTCATCCTGCTCAAGTCCGCGCTCTGGACGCTGCTGCGCGTCTGC
CGGCTCAGCGGCCGCCCCGAGCTGTGGGATGTCTTCCTGCGGCTGATCGACGAATATCGC
CGGCATCTGACCACGTTCGAGGTCACGGTGTGGCAGGCGGCCGCGGATCCCGCACGAGCC
GACGTCGCTCGGCTCGCGGTCGTCGACCGGGAGATCGCCTCCGCGATGACGGACAAGGAC
CACAACAGGATCATCCGGCTGGCCGAGGCGTGTGCCCCGGTCGACCGGCTGGGCGAGATG
CGGGCCGCCCTGTGGCGGGTGGCGCAGAGCGGCCGGAACGGCCTGCAGCCCACGACCCAC
GCGATCCGGGCCCTCAACTTCCTGTGCGCCGACGCTCTGACGCATGGGCGCTGGTCTGAC
GTGGACACACTCAGTGAGGAGATCACCCGCCTCTGCGAGGGGAACAGCCAGCGGGCCCTC
TTCTGGCTCACCGAAGGCAGCGTCGCCATCCTCGCCGCGCTGCGCGGCGACACCGAGCGT
GCGCGGGCGCTGACCCGTGAGATGGTCGCCTGGGCGGTGCCTCGTGACGCGCGGGTGGTA
CTGCTGCTCGCCGCGCACGCACGGATGCTCGACGCCCTCGGCGCCGCCGATTTCGAGGCG
GCCTACCAGTACGTGGCGGAGGCCGGCCTGCCCGACCTGACGAAGTCCTCGTCGATCGAG
CACATGCAGATGTCCTTCGACATCGTCCTGGCCACCGTCCACACCGAGCGGCACCGCGAG
GCCGAGCGGTACGTCCGGGCGATGCAGGCGTCGGAGATGGCGTCGCTGTCGCCCCGGCTG
GCACTGCAGACGGCGGCCTGCGCGGCCCTGGTGGCACCCCGGGCCAAGGCCGCCCGGAAC
TACGAGACCGCGCTCGCCTTGCCGGGCGTCAACCGCCTGCCCTACGACCGCGCTCGCGTC
CAGCTCGCGTACGGCGAGCACCTGCGCCGGGTCCGGGCGACCAACGAGGCCCGGCGCCAC
CTGCGCACCGCCCTCAACTCGTTCCATGACCTCGGCGCGCAGCGCTGGGCGGCCCGGGCC
AAGGCCGAGCTGCGCGCCGCCGGCGACCGCGACACCGCCGCCGAGCCGGCCGAGTCGGCC
GCACTGACGCCGCAGGAGCTGGCGATCGTCCGACTCGCCGCCAACGGGCTGACGAACAAG
CAGATCGGCAAGCGGCTGTTCCTCTCGCCCCGGACCGTGGCCAACCATCTCTACCGGGCC
TTCCCCAAGCTGGACATCACGTCCCGGGCCAGCCTCCGGGACGCGCTCGCCTCGCTGCAG
CTGGAGGACACGGGTGTTCCCACCCCTTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000792 Transcription regulator LuxR, C-terminal (Domain)
 [976-1003]  PS00622
PS00622   HTH_LUXR_1
 [962-976]  1.19999985703101e-08 PR00038 [976-992]  1.19999985703101e-08 PR00038 [992-1004]  1.19999985703101e-08 PR00038
PR00038   HTHLUXR
 [955-1020]  PS50043
PS50043   HTH_LUXR_2
 [960-1012]  4.6e-15 PF00196
PF00196   GerE
 [959-1016]  5.99999044089058e-20 SM00421
SM00421   HTH_LUXR
IPR003593 AAA+ ATPase domain (Domain)
 [137-311]  6.09999977126211e-05 SM00382
SM00382   AAA
IPR011990 Tetratricopeptide-like helical (Domain)
 [749-972]  1.7e-12 G3DSA:1.25.40.10
G3DSA:1.25.40.10   TPR-like_helical
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [973-1018]  1.4e-17 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [940-1026]  4.90001027782405e-17 SSF46894
SSF46894   Bipartite_resp_reg_C-effector
SignalP No significant hit
TMHMM No significant hit
Tatmc_00130 Tatmc_00130   last last