close all open/close all
first first   Tauto_00020 Tauto_00020

CDS information : Tauto_00010


close this sectionLocation

Organism
Strain
Entry nameTautomycin
Contig
Start / Stop / Direction1,027 / 347 / - [in whole cluster]
1,027 / 347 / - [in contig]
Locationcomplement(347..1027) [in whole cluster]
complement(347..1027) [in contig]
TypeCDS
Length681 bp (226 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)conserved hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in tautomycin biosynthesis.
Note (GenBank)
  • orf(-6)
Reference
ACC
PmId
[18708355] Characterization of the tautomycin biosynthetic gene cluster from Streptomyces spiroverticillatus unveiling new insights into dialkylmaleic anhydride and polyketide biosynthesis. (J Biol Chem. , 2008)

close this sectionSequence

selected fasta
>hypothetical protein [conserved hypothetical protein]
MWRSPAPVSARGCTVRPVTLALLHTSPVHVPVFDALRDTDHPGFALRHLVHEDLLVRAGE
SGPEAVSGEIRDLLAGAVTEGASAVLCTCSTIGGVAESAAAMIGVPVLRVDRPMAAAAAE
HARVVVLAALAATLAPTLALLAEEAGERPVDVRAVLVDGAWARFRAGDRDGFLDLIAAAV
ERVTDADVIVLAQASMADAGARTVTRIPVLSSPRSGLAAAVAAAGG
selected fasta
>hypothetical protein [conserved hypothetical protein]
GTGTGGCGCAGCCCTGCCCCCGTTTCGGCCCGTGGCTGTACCGTTCGACCGGTGACGCTC
GCCCTGCTGCACACCTCTCCGGTCCATGTGCCGGTCTTCGACGCCCTCCGGGACACGGAC
CATCCCGGGTTCGCCCTGCGGCACCTCGTGCACGAGGACCTGCTCGTTCGGGCCGGGGAA
TCCGGCCCCGAAGCGGTGTCGGGCGAGATCCGGGACCTGCTCGCGGGTGCCGTCACCGAG
GGTGCGTCCGCCGTGCTCTGCACGTGCTCCACGATCGGCGGGGTCGCGGAGTCGGCAGCG
GCGATGATCGGCGTTCCGGTGCTCCGCGTCGACCGCCCGATGGCGGCGGCCGCGGCGGAG
CATGCGCGTGTGGTGGTCCTCGCGGCACTCGCCGCCACCCTGGCGCCGACCCTCGCTCTT
CTCGCCGAGGAGGCGGGGGAACGCCCGGTCGATGTCCGCGCCGTCCTCGTCGACGGGGCC
TGGGCACGCTTCCGGGCGGGTGACCGCGACGGCTTCCTGGACCTGATCGCGGCCGCGGTC
GAGAGGGTGACGGACGCCGATGTGATCGTGCTGGCACAGGCGTCCATGGCCGACGCCGGC
GCGCGCACGGTCACTCGGATCCCGGTGCTGTCCAGCCCCCGCTCGGGCCTGGCCGCCGCG
GTCGCCGCCGCGGGTGGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP
 [1-30]  0.376 Signal
Bacteria, Gram-negative   
 [1-25]  0.571 Signal
Eukaryota   
TMHMM No significant hit
first first   Tauto_00020 Tauto_00020