close all open/close all

CDS information : Tauto_00020


close this sectionLocation

Organism
Strain
Entry nameTautomycin
Contig
Start / Stop / Direction1,427 / 1,065 / - [in whole cluster]
1,427 / 1,065 / - [in contig]
Locationcomplement(1065..1427) [in whole cluster]
complement(1065..1427) [in contig]
TypeCDS
Length363 bp (120 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative acetyltransferase
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in tautomycin biosynthesis.
Note (GenBank)
  • orf(-5)
Reference
ACC
PmId
[18708355] Characterization of the tautomycin biosynthetic gene cluster from Streptomyces spiroverticillatus unveiling new insights into dialkylmaleic anhydride and polyketide biosynthesis. (J Biol Chem. , 2008)
Family/Domain
FD
IPR000182

close this sectionSequence

selected fasta
>putative acetyltransferase [hypothetical protein]
MAEQTERTEIDIRDDRASGNLLAYDSGKAAGVVAYFVMDGEPAALVAVHTVVEPGHEGKG
IAGALVQEFYAMAGREGVPVVPLCPYAAQWARRHPDLAPEAPSELVERAKTQLTSHPELD
selected fasta
>putative acetyltransferase [hypothetical protein]
ATGGCGGAACAGACCGAACGGACCGAGATCGACATCCGCGACGACCGGGCGAGCGGCAAT
CTGCTCGCGTACGACAGCGGCAAGGCCGCCGGGGTCGTCGCGTACTTCGTGATGGACGGT
GAGCCGGCCGCGCTCGTCGCCGTCCACACCGTCGTCGAACCCGGTCACGAGGGCAAGGGC
ATCGCGGGCGCCCTCGTCCAGGAGTTCTACGCCATGGCGGGCCGCGAGGGCGTCCCCGTC
GTCCCGCTCTGCCCGTACGCGGCGCAATGGGCGCGGCGCCACCCCGACCTGGCCCCCGAA
GCCCCCTCCGAACTGGTTGAGCGGGCGAAGACGCAGCTCACGTCGCACCCCGAGCTGGAC
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000182 GNAT domain (Domain)
 [24-83]  0.00026 PF00583
PF00583   Acetyltransf_1
 [1-112]  PS51186
PS51186   GNAT
IPR016181 Acyl-CoA N-acyltransferase (Domain)
 [9-106]  1.79999754022375e-17 SSF55729
SSF55729   Acyl_CoA_acyltransferase
 [10-97]  2.8e-17 G3DSA:3.40.630.30
G3DSA:3.40.630.30   Acyl_CoA_acyltransferase
SignalP No significant hit
TMHMM No significant hit