close all open/close all

CDS information : Tauto_00030


close this sectionLocation

Organism
Strain
Entry nameTautomycin
Contig
Start / Stop / Direction1,942 / 1,316 / - [in whole cluster]
1,942 / 1,316 / - [in contig]
Locationcomplement(1316..1942) [in whole cluster]
complement(1316..1942) [in contig]
TypeCDS
Length627 bp (208 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.2 function unknown
Productpeptidase C14 family protein
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in tautomycin biosynthesis.
Note (GenBank)
  • orf(-4)
Reference
ACC
PmId
[18708355] Characterization of the tautomycin biosynthetic gene cluster from Streptomyces spiroverticillatus unveiling new insights into dialkylmaleic anhydride and polyketide biosynthesis. (J Biol Chem. , 2008)
Family/Domain
FD
IPR011600
Merops
C14

close this sectionSequence

selected fasta
>peptidase C14 family protein [hypothetical protein]
MTRLSAPGTRVLLIGTGTHGAASGLPPVPAVMGTLADLGQVLVERCGLAEENLRVIRDPA
NPTELGIAIAQEAERAEDVLWVYYVGHGLVNPAGELYLATVATDSRPGWVAYTALAYTAV
RGSLLQTAARSIVVVLDCCFSGRAVDVLGSAEEQEVDLARVLPSAPSREHPSWRNRPNGP
RSTSATTGRAAICSRTTAARPPGSSRTS
selected fasta
>peptidase C14 family protein [hypothetical protein]
ATGACCAGGTTGAGTGCGCCGGGGACTCGAGTGCTGCTGATCGGCACCGGCACCCACGGC
GCGGCCTCCGGTCTGCCGCCGGTTCCGGCGGTGATGGGTACTCTGGCCGATCTGGGGCAG
GTGCTGGTCGAGCGGTGCGGGCTGGCTGAGGAGAACCTGCGTGTGATACGCGACCCGGCG
AACCCAACCGAGCTGGGGATCGCGATCGCGCAGGAGGCCGAGCGCGCCGAGGATGTGCTG
TGGGTCTATTACGTGGGGCATGGCCTGGTCAACCCCGCTGGTGAGCTGTATCTGGCCACG
GTTGCCACCGACTCGCGCCCGGGCTGGGTGGCTTACACCGCGCTGGCCTACACAGCGGTC
CGCGGCTCACTGCTGCAGACGGCGGCTCGCTCGATCGTCGTCGTGCTCGACTGCTGCTTC
TCCGGGCGGGCGGTGGATGTCCTTGGCAGCGCCGAGGAGCAGGAGGTAGACCTCGCCCGG
GTTCTCCCGTCCGCACCTTCGAGGGAGCACCCGTCATGGCGGAACAGACCGAACGGACCG
AGATCGACATCCGCGACGACCGGGCGAGCGGCAATCTGCTCGCGTACGACAGCGGCAAGG
CCGCCGGGGTCGTCGCGTACTTCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011600 Peptidase C14, caspase catalytic (Domain)
 [38-186]  1.9e-06 PF00656
PF00656   Peptidase_C14
SignalP
 [1-24]  0.939 Signal
Eukaryota   
 [1-21]  0.359 Signal
Bacteria, Gram-positive   
TMHMM No significant hit