close all open/close all

CDS information : Tauto_00040


close this sectionLocation

Organism
Strain
Entry nameTautomycin
Contig
Start / Stop / Direction3,213 / 2,500 / - [in whole cluster]
3,213 / 2,500 / - [in contig]
Locationcomplement(2500..3213) [in whole cluster]
complement(2500..3213) [in contig]
TypeCDS
Length714 bp (237 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative oxidoreductase
Product (GenBank)putative dehydrogenase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in tautomycin biosynthesis.
Note (GenBank)
  • orf(-3)
Reference
ACC
PmId
[18708355] Characterization of the tautomycin biosynthetic gene cluster from Streptomyces spiroverticillatus unveiling new insights into dialkylmaleic anhydride and polyketide biosynthesis. (J Biol Chem. , 2008)
Family/Domain
FD
IPR002198

close this sectionSequence

selected fasta
>putative oxidoreductase [putative dehydrogenase]
MSSEKKVAIVTGASQGIGAAVADAYRGRGYAVVVTARSIPSSHDPDVLAVPGDLSRPGTG
AQIVEQALDRFGRIDTLVNNAGVYREKPFTDYTDADYDLVTGVNLRGFFDVTRSAIPAML
AGGDGGHVLCVSTSLVDRANARIPAALASLTKGGLVAATKELAIEYAARRIRANAVSLGV
IRTPMHPDDPGGTLAALHPLGRMGEIDDVVEAIMYLEQASFVTGEILHVDGGQSAGF
selected fasta
>putative oxidoreductase [putative dehydrogenase]
ATGAGCTCGGAGAAGAAGGTGGCAATCGTCACCGGTGCTTCACAAGGCATCGGCGCGGCC
GTCGCCGACGCGTACCGCGGGCGCGGGTACGCCGTCGTCGTGACTGCCCGGTCCATCCCC
TCGTCGCACGATCCGGACGTACTCGCCGTGCCCGGCGACCTGAGCCGGCCCGGCACCGGT
GCGCAGATCGTCGAGCAGGCGCTGGACCGCTTCGGCCGGATCGACACTCTGGTGAACAAC
GCCGGCGTCTACCGGGAGAAACCATTCACCGACTACACCGACGCCGACTACGACCTGGTG
ACCGGCGTCAACCTGCGCGGCTTCTTCGACGTCACGCGCAGCGCCATCCCCGCGATGCTC
GCGGGCGGCGACGGCGGGCACGTCCTGTGCGTGTCGACGTCGCTGGTCGACCGCGCCAAC
GCGCGCATACCCGCGGCGCTCGCCTCGCTGACCAAAGGCGGCCTGGTCGCGGCGACGAAG
GAGCTGGCCATCGAATACGCGGCGCGCCGCATCCGCGCCAACGCCGTCTCACTCGGCGTC
ATCCGCACTCCGATGCACCCGGACGACCCGGGCGGCACGCTCGCCGCGCTGCACCCGCTC
GGGCGGATGGGTGAGATCGACGACGTCGTCGAGGCGATCATGTACCTCGAACAGGCCTCG
TTCGTCACCGGCGAGATCCTGCACGTCGACGGCGGCCAGAGCGCCGGCTTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [72-83]  4.69999810630989e-05 PR00080 [148-167]  4.69999810630989e-05 PR00080
PR00080   SDRFAMILY
IPR002347 Glucose/ribitol dehydrogenase (Family)
 [7-24]  1e-29 PR00081 [72-83]  1e-29 PR00081 [148-167]  1e-29 PR00081 [169-186]  1e-29 PR00081 [199-219]  1e-29 PR00081
PR00081   GDHRDH
IPR016040 NAD(P)-binding domain (Domain)
 [2-235]  4.10000000000004e-62 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP
 [1-22]  0.839 Signal
Bacteria, Gram-negative   
 [1-22]  0.532 Signal
Eukaryota   
TMHMM No significant hit