close all open/close all

CDS information : Tauto_00050


close this sectionLocation

Organism
Strain
Entry nameTautomycin
Contig
Start / Stop / Direction3,409 / 5,178 / + [in whole cluster]
3,409 / 5,178 / + [in contig]
Location3409..5178 [in whole cluster]
3409..5178 [in contig]
TypeCDS
Length1,770 bp (589 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative oxidoreductase
Product (GenBank)putative MOSC ferredoxin--oxidoreductase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in tautomycin biosynthesis.
Note (GenBank)
  • orf(-2)
Reference
ACC
PmId
[18708355] Characterization of the tautomycin biosynthetic gene cluster from Streptomyces spiroverticillatus unveiling new insights into dialkylmaleic anhydride and polyketide biosynthesis. (J Biol Chem. , 2008)
Family/Domain
FD
IPR017927, IPR001433

close this sectionSequence

selected fasta
>putative oxidoreductase [putative MOSC ferredoxin--oxidoreductase]
MAALIAVNVGMPKDVPWHGRATRTGIWKHPVAGPVMARRLNLDGDGQGDLAGHGGEQRAV
LVYQLSSYRHWQEYLKRDDFTYGQFGENLTVDGLADDEVCIGDRYEIGGAVFEVTQPRVT
CYRVGLRLGEPQMAALLVSHRRPGFYMRVLTEGRVRAGDEIVKIASGPEEMTVAEIDALL
YLPGHARPQLERALRIPALSPGWKTSLRALLDDADRGSGAVGGNRGLTTSSPPPAWPGFR
RLEVARIEPESASIFSLTLAAVDGEPLPAALPGQFLTVRLRPDPRASPVIRNYSLSGRPG
AETYRISVKQEPHGVASTYLRQHVKVGDVLDVAAPRGTFLLADADTPVLLLSAGVGATPV
LAMLHALAAERSQRAVWWLHAARDGESHPFAGEARALLSRLPAGRSFVSYSRPSGVDRPG
VDYTFSGRFSPERIRGLEPPPDADAYICGPSAFMGDMTGALEACGLPSSRIHTEVFGATS
AVTPGVVTGSARAPHQPAAPPGGRPGPSVAFARSGLIVPWHPDYGTLLGLAEACDVPVRW
SCRTGICHTCETALLSGHVEYDPQPLEPPSGGSALICCSTPPADVVLDM
selected fasta
>putative oxidoreductase [putative MOSC ferredoxin--oxidoreductase]
ATGGCCGCTCTGATCGCCGTGAACGTCGGCATGCCCAAGGACGTCCCCTGGCACGGCAGG
GCCACCCGCACCGGCATCTGGAAGCACCCCGTCGCCGGGCCCGTGATGGCGCGCCGCCTC
AACCTGGACGGCGACGGGCAGGGTGACCTCGCCGGGCACGGCGGCGAGCAGCGTGCCGTG
CTGGTCTACCAGTTGAGCTCCTATCGCCATTGGCAGGAGTACCTGAAGCGGGACGACTTC
ACGTACGGACAGTTCGGCGAGAACCTCACTGTGGACGGACTCGCCGACGACGAGGTGTGC
ATCGGTGACCGCTACGAGATCGGCGGTGCGGTCTTCGAGGTCACCCAACCCCGCGTGACG
TGCTACCGCGTGGGGTTGCGGCTCGGCGAGCCGCAGATGGCCGCCCTGCTGGTGTCCCAT
CGCCGCCCGGGCTTCTACATGCGGGTGCTGACTGAAGGGCGGGTGCGGGCCGGGGACGAG
ATCGTGAAGATCGCCTCGGGCCCCGAGGAGATGACGGTCGCGGAGATCGACGCGCTGCTC
TACCTGCCCGGCCACGCCCGGCCGCAGCTCGAACGGGCCCTGCGCATCCCCGCGTTGAGC
CCCGGTTGGAAGACGTCGCTGCGAGCCCTGCTCGACGACGCGGATCGCGGCTCCGGCGCC
GTGGGTGGAAACCGCGGGCTGACCACCAGCAGCCCGCCGCCGGCCTGGCCCGGGTTCCGT
CGGCTCGAAGTCGCCCGCATCGAGCCGGAGAGCGCGAGCATCTTCTCGCTCACTCTGGCG
GCAGTCGACGGTGAGCCGCTCCCAGCCGCTCTGCCGGGGCAGTTCCTCACGGTCCGCCTG
CGGCCGGACCCACGGGCCTCCCCGGTCATCCGCAACTACTCGCTCTCCGGCCGACCGGGC
GCCGAGACGTACCGCATCAGTGTCAAGCAGGAACCACACGGCGTCGCCAGCACCTACCTG
CGTCAGCACGTGAAGGTGGGTGATGTTCTCGATGTCGCCGCTCCGCGCGGCACGTTCCTG
CTCGCGGACGCGGACACTCCGGTCCTGCTGCTGTCCGCCGGTGTCGGTGCCACCCCGGTC
CTGGCCATGCTGCACGCTCTGGCCGCGGAGCGCTCGCAGCGCGCGGTGTGGTGGCTGCAC
GCGGCCCGGGACGGCGAGAGCCACCCGTTCGCCGGCGAAGCGCGCGCACTGCTCTCCCGG
CTGCCCGCAGGCCGGTCGTTCGTCTCCTACAGCCGTCCGTCAGGTGTCGACCGCCCAGGT
GTCGACTACACGTTCAGTGGGCGGTTCAGTCCCGAGCGGATCCGCGGCCTGGAGCCGCCT
CCGGACGCCGACGCCTACATCTGCGGGCCGAGCGCGTTCATGGGGGACATGACCGGAGCC
CTGGAGGCCTGCGGCCTGCCGTCCTCCCGGATCCACACCGAGGTCTTCGGGGCCACGTCC
GCCGTCACCCCCGGTGTGGTGACCGGATCCGCCCGGGCACCGCACCAGCCGGCCGCTCCT
CCCGGCGGCCGCCCGGGGCCGTCCGTAGCCTTCGCGCGCAGCGGGCTGATCGTCCCCTGG
CACCCTGACTACGGGACGCTGCTCGGACTCGCCGAGGCGTGCGACGTGCCCGTGCGCTGG
TCCTGCCGCACCGGAATCTGTCACACCTGCGAGACCGCGCTTCTCTCCGGCCACGTCGAG
TACGACCCGCAGCCCCTGGAGCCCCCCTCCGGAGGAAGCGCGCTCATCTGCTGTTCGACG
CCCCCGGCCGACGTGGTCCTGGACATGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000951 Phthalate dioxygenase reductase (Family)
 [264-274]  4.89999951782359e-08 PR00409 [327-341]  4.89999951782359e-08 PR00409 [349-368]  4.89999951782359e-08 PR00409
PR00409   PHDIOXRDTASE
IPR001041 2Fe-2S ferredoxin-type domain (Domain)
 [466-589]  4.40000933643892e-19 SSF54292
SSF54292   Ferredoxin
 [525-581]  1.9e-06 PF00111
PF00111   Fer2
IPR001433 Oxidoreductase FAD/NAD(P)-binding (Domain)
 [350-456]  6.50000000000001e-07 PF00175
PF00175   NAD_binding_1
IPR005163 3-alpha domain (Domain)
 [170-212]  1.5e-07 PF03475
PF03475   3-alpha
IPR005302 Molybdenum cofactor sulfurase, C-terminal (Domain)
 [42-161]  9.20000000000002e-27 PF03473
PF03473   MOSC
 [29-164]  PS51340
PS51340   MOSC
IPR008333 Oxidoreductase, FAD-binding domain (Domain)
 [244-339]  4.5e-10 PF00970
PF00970   FAD_binding_6
IPR011037 Pyruvate kinase-like, insert domain (Domain)
 [1-213]  3.1999989904635e-63 SSF50800
SSF50800   PK_B_barrel_like
IPR012675 Beta-grasp domain (Domain)
 [473-588]  5.90000000000001e-18 G3DSA:3.10.20.30
G3DSA:3.10.20.30   Ferredoxin_fold
IPR015808 Molybdenum cofactor sulfurase, C-terminal-like (Domain)
 [1-213]  1.79999999999997e-72 G3DSA:2.40.33.20
G3DSA:2.40.33.20   MoCF_Sase_C-like
IPR017927 Ferredoxin reductase-type FAD-binding domain (Domain)
 [237-342]  PS51384
PS51384   FAD_FR
IPR017938 Riboflavin synthase-like beta-barrel (Domain)
 [236-341]  3.39999972437717e-29 SSF63380
SSF63380   Riboflavin_synthase_like_b-brl
SignalP
 [1-37]  0.124 Signal
Eukaryota   
TMHMM No significant hit