close all open/close all

CDS information : Tauto_00060


close this sectionLocation

Organism
Strain
Entry nameTautomycin
Contig
Start / Stop / Direction5,384 / 6,079 / + [in whole cluster]
5,384 / 6,079 / + [in contig]
Location5384..6079 [in whole cluster]
5384..6079 [in contig]
TypeCDS
Length696 bp (231 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in tautomycin biosynthesis.
Note (GenBank)
  • orf(-1)
Reference
ACC
PmId
[18708355] Characterization of the tautomycin biosynthetic gene cluster from Streptomyces spiroverticillatus unveiling new insights into dialkylmaleic anhydride and polyketide biosynthesis. (J Biol Chem. , 2008)

close this sectionSequence

selected fasta
>hypothetical protein [hypothetical protein]
MAKVLFIVSGATYWVLKDGTRHATGYWAEEFANPYKILTDAGHEVVVATPNGVTPTVDMM
SLRPEMVGGNDSALELEAIIRSAEVMRRPLQLSDVRLEDYDAVYLPGGHGPMADLAWDAD
VGRLLTQQLTSGNPLFVVCHGPAAMLATRIHGESPFKGYNITCFTDEEEDGVGLASRAPW
LLETDVRTKVGVNFSRGPIWEPYVVEDRNLVTGQNPASAAVLGNRMLEILK
selected fasta
>hypothetical protein [hypothetical protein]
GTGGCAAAGGTGCTTTTCATCGTCAGCGGAGCCACCTACTGGGTGTTGAAGGACGGCACA
CGGCACGCGACCGGCTACTGGGCCGAGGAGTTCGCGAACCCGTACAAGATCCTCACGGAC
GCCGGTCACGAGGTCGTCGTCGCGACGCCGAACGGTGTGACGCCGACCGTCGACATGATG
AGCCTGCGCCCCGAGATGGTCGGTGGAAACGACAGCGCCCTGGAGCTGGAGGCCATCATC
CGTTCCGCGGAGGTGATGCGTCGACCGCTACAGCTGTCGGACGTGCGCCTGGAGGACTAC
GACGCGGTCTACCTGCCGGGTGGTCACGGGCCGATGGCGGACCTGGCGTGGGACGCCGAC
GTGGGGCGGCTACTGACCCAGCAGTTGACCTCGGGCAACCCGCTGTTCGTCGTCTGTCAC
GGTCCCGCCGCGATGCTGGCCACCAGGATCCACGGTGAGTCGCCGTTCAAGGGCTACAAC
ATCACCTGCTTCACCGACGAGGAGGAGGACGGCGTCGGACTGGCCTCCAGGGCGCCGTGG
CTGCTGGAGACCGACGTGAGGACGAAGGTCGGGGTCAACTTCAGCCGTGGTCCGATCTGG
GAGCCCTACGTGGTCGAGGACCGCAACCTGGTGACCGGACAGAACCCGGCCTCGGCCGCG
GTCCTCGGGAACCGGATGCTGGAGATCCTCAAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002818 ThiJ/PfpI (Domain)
 [87-230]  1.1e-22 PF01965
PF01965   DJ-1_PfpI
SignalP
 [1-23]  0.261 Signal
Bacteria, Gram-positive   
TMHMM No significant hit