close all open/close all

CDS information : Tauto_00070


close this sectionLocation

Organism
Strain
Entry nameTautomycin
Contig
Start / Stop / Direction7,322 / 8,611 / + [in whole cluster]
7,322 / 8,611 / + [in contig]
Location7322..8611 [in whole cluster]
7322..8611 [in contig]
TypeCDS
Length1,290 bp (429 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative LuxR family transcriptional regulator
Product (GenBank)putative regulatory protein
Gene
Gene (GenBank)ttmF
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[18708355] Characterization of the tautomycin biosynthetic gene cluster from Streptomyces spiroverticillatus unveiling new insights into dialkylmaleic anhydride and polyketide biosynthesis. (J Biol Chem. , 2008)
Family/Domain
FD
IPR000792

close this sectionSequence

selected fasta
>putative LuxR family transcriptional regulator [putative regulatory protein]
MRDSRSQLHTQLPHTPSEGPTATAADDQRDDPLARSLSAWLAGEVHRAIELATTPGGDEN
DPRHAKIWHARLLTRVRELPEATRVLDELTTSYDVADDGGVSAALTTCRAEFALASGDAG
SAFAEANVGLGLAEGAGAYALLPDLHVVLALSAVRQSATSTGLRFARNLGDDALLGRTAH
MRGQCVWAAAQAFEADGGPACVSHLVERLISDDQLTQELLASQPAAAAWLVRLARSMGDE
RLAFKCVVRAESFILKSWGFRSPYAAALHAKGLFEKNPDKLRAACELYPDGWASASAAED
LAQTWSSLRLGRDRAAEQLKRAAAGYERAGAARDLARVASKLRELGVRSGRVRRPMRCDG
HRTGSLTDTEFAVADLVSQGLTNVQVGRQLYISAHTVAFHLKKIFRKMEVSSRVELARTW
VNSDQQTVG
selected fasta
>putative LuxR family transcriptional regulator [putative regulatory protein]
ATGCGTGATAGCCGGTCCCAGCTGCACACCCAGCTGCCCCACACACCGTCTGAAGGTCCT
ACCGCCACCGCGGCCGACGACCAGCGAGACGACCCGCTCGCACGCTCCTTGTCCGCCTGG
CTCGCCGGTGAGGTCCACCGGGCCATCGAGCTGGCCACCACACCCGGCGGCGACGAGAAC
GACCCGAGGCACGCCAAGATCTGGCACGCCCGGCTCCTGACCCGCGTCCGCGAACTTCCG
GAAGCCACGCGGGTGCTCGACGAGTTGACCACCTCGTACGACGTCGCCGACGACGGGGGT
GTTTCAGCCGCGTTGACCACCTGCCGCGCCGAGTTCGCGCTCGCGTCGGGTGACGCCGGC
AGCGCGTTCGCCGAGGCGAACGTCGGCCTCGGGCTGGCCGAAGGGGCCGGCGCCTACGCC
TTGCTGCCGGACCTGCACGTCGTCCTGGCGCTGAGCGCCGTCCGGCAGTCCGCCACGTCG
ACCGGCCTGCGATTCGCGCGCAACCTGGGCGATGACGCTCTGCTCGGCCGCACTGCGCAC
ATGCGCGGGCAGTGCGTGTGGGCCGCCGCTCAGGCGTTCGAGGCCGACGGCGGTCCGGCC
TGCGTCAGTCACCTCGTCGAGCGCCTGATCTCCGACGACCAGCTGACGCAGGAACTCCTC
GCGTCCCAGCCCGCCGCCGCGGCGTGGCTCGTCCGCCTCGCGCGAAGCATGGGAGACGAG
CGACTCGCCTTCAAGTGTGTGGTGCGAGCCGAGTCGTTCATCCTGAAGTCGTGGGGTTTT
CGTTCGCCCTACGCGGCGGCACTGCACGCCAAAGGGCTGTTCGAAAAGAATCCTGACAAA
CTGCGCGCCGCTTGCGAACTGTATCCGGACGGCTGGGCGTCGGCGTCAGCCGCCGAAGAC
CTGGCCCAGACGTGGTCCTCGCTGCGCCTGGGCCGGGATCGCGCCGCCGAACAGTTGAAA
CGCGCAGCCGCCGGTTATGAGCGGGCCGGTGCGGCCCGCGACCTCGCCCGGGTCGCGAGC
AAGCTTCGTGAGCTCGGCGTGCGATCGGGCCGCGTGCGGCGGCCGATGCGCTGCGACGGA
CACCGCACCGGCTCCCTCACGGACACCGAGTTCGCGGTGGCCGACCTGGTGAGCCAGGGC
CTGACGAACGTACAGGTCGGCCGCCAGCTCTACATCTCCGCGCACACCGTGGCGTTCCAT
CTGAAGAAGATCTTCCGCAAGATGGAGGTCTCTTCGCGGGTGGAACTGGCCCGCACGTGG
GTTAACTCGGATCAGCAAACCGTCGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000792 Transcription regulator LuxR, C-terminal (Domain)
 [359-424]  PS50043
PS50043   HTH_LUXR_2
 [366-380]  5.99999702863249e-08 PR00038 [380-396]  5.99999702863249e-08 PR00038 [396-408]  5.99999702863249e-08 PR00038
PR00038   HTHLUXR
 [365-418]  2e-14 PF00196
PF00196   GerE
 [363-420]  4.00000300869883e-19 SM00421
SM00421   HTH_LUXR
IPR011990 Tetratricopeptide-like helical (Domain)
 [185-372]  6.60000000000002e-10 G3DSA:1.25.40.10
G3DSA:1.25.40.10   TPR-like_helical
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [373-421]  1.4e-18 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [344-426]  2.2999993566538e-14 SSF46894
SSF46894   Bipartite_resp_reg_C-effector
SignalP
 [1-10]  0.184 Signal
Bacteria, Gram-negative   
 [1-24]  0.198 Signal
Bacteria, Gram-positive   
TMHMM No significant hit