close all open/close all

CDS information : Tauto_00080


close this sectionLocation

Organism
Strain
Entry nameTautomycin
Contig
Start / Stop / Direction9,206 / 8,676 / - [in whole cluster]
9,206 / 8,676 / - [in contig]
Locationcomplement(8676..9206) [in whole cluster]
complement(8676..9206) [in contig]
TypeCDS
Length531 bp (176 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative decarboxylase
Product (GenBank)putative decarboxylase
Gene
Gene (GenBank)ttmG
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[18708355] Characterization of the tautomycin biosynthetic gene cluster from Streptomyces spiroverticillatus unveiling new insights into dialkylmaleic anhydride and polyketide biosynthesis. (J Biol Chem. , 2008)
Family/Domain
FD
IPR003779

close this sectionSequence

selected fasta
>putative decarboxylase [putative decarboxylase]
MARIPYLTSSTASETIAEPLSKLPSLHVFGLMAHAETVFRPWLRFSGALLNHLALDPVLR
ELAILRVGQLAARYEWDQHVPLALAVGATQQQIDALDRGDLDALEPLPRAVVDFVTGVVR
DEVDDAIYSSVSAFLDDREVVELTLVAGHYLMVARMMTTLRIDPDPAAGADALLLG
selected fasta
>putative decarboxylase [putative decarboxylase]
ATGGCGCGCATTCCCTATCTCACTTCCTCCACCGCTTCCGAAACCATCGCCGAACCGCTG
TCGAAACTGCCATCGCTCCACGTTTTCGGATTGATGGCCCACGCCGAGACCGTGTTCCGG
CCGTGGCTGCGTTTCAGCGGAGCGCTGCTCAACCACCTCGCCCTGGACCCGGTGCTGCGC
GAGTTGGCGATTCTGCGGGTCGGGCAGCTCGCCGCCCGCTACGAGTGGGACCAGCACGTG
CCCCTCGCGCTGGCGGTGGGCGCGACTCAGCAGCAGATCGACGCGCTGGATCGGGGTGAC
CTCGATGCGCTGGAGCCGTTGCCGCGCGCCGTGGTCGACTTCGTGACGGGCGTAGTGCGC
GACGAGGTCGACGACGCGATCTACTCGTCGGTCAGTGCGTTCCTGGACGACCGGGAAGTC
GTGGAACTCACGCTCGTCGCGGGCCACTACCTGATGGTGGCCCGGATGATGACGACCCTG
CGCATCGACCCCGACCCGGCGGCCGGAGCGGACGCGCTGTTGCTCGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003779 Carboxymuconolactone decarboxylase (Domain)
 [38-96]  1.2e-08 PF02627
PF02627   CMD
SignalP
 [1-35]  0.077 Signal
Eukaryota   
 [1-35]  0.283 Signal
Bacteria, Gram-positive   
TMHMM No significant hit