close all open/close all

CDS information : Tauto_00090


close this sectionLocation

Organism
Strain
Entry nameTautomycin
Contig
Start / Stop / Direction26,681 / 9,369 / - [in whole cluster]
26,681 / 9,369 / - [in contig]
Locationcomplement(9369..26681) [in whole cluster]
complement(9369..26681) [in contig]
TypeCDS
Length17,313 bp (5,770 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)type I modular polyketide synthase
Gene
Gene (GenBank)ttmH
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[18708355] Characterization of the tautomycin biosynthetic gene cluster from Streptomyces spiroverticillatus unveiling new insights into dialkylmaleic anhydride and polyketide biosynthesis. (J Biol Chem. , 2008)

close this sectionPKS/NRPS Module

10 malonyl-CoA
11 methylmalonyl-CoA
12 malonyl-CoA
KS34..411
AT571..883
dh931..1084
KR1381..1561
ACP1662..1732
KS1755..2129
AT2281..2595
DH2644..2814
ER3125..3431
KR3441..3620
ACP3717..3791
KS3814..4190
AT4340..4651
dh4697..4866
kr5150..5316
ACP5400..5470
TE5548..5766

close this sectionSequence

selected fasta
>polyketide synthase [type I modular polyketide synthase]
MTVPVDKLTEALRVSLLANSRLREENRALVDATNEPIALVGMACRFPGGVRGPEDLWRLV
ADGVDGVGPFPADRGWDLDTLLGPDGSGSGTSATGEGGFLDEPGEFDAAFFRISPREAVA
TDPQQRLLLEVSWEALEHAGIDPSSLAGSRTGVFTGAYQSGYAELVARGGEQLRAHQITG
GAGSVISGRIAYTLGLEGPAVSVDTACSSSLVAMHLAAQALRAGDCTLALAGGVTVMASP
GMFLGFTAQGGLAADGRCKSFSDGADGTGWAEGAGVVVLERLSDARRHGHEVLAVLRSSA
VNQDGASNGLTAPNGPSQQRVIRQALAAAGLSASDVDVVEAHGTGTRLGDPIEAQAVLAT
YGQDRPEGRPLWLGSLKSNIGHAQAAAGVGGVIKTVLALRHGILPKTLHVDEPSRQVDWS
QGDVRLLTEAMPWPETGRPRRAGVSSFGVSGTNAHVILEAAGEAAVGPAGPPSGPPAVEG
VVPWVVSGKSADAVRAQAARLLERLQAEPALSPADVGWSLLTSRAAFDHRAVVVGGDRTE
LMAGLRATADGEPAANVALGTARSGAKLGVLFTGQGAQRVGMARELYDRSPVFAGALDEI
LVELDPLLDRPLCEVMWGEDAELINETGWAQPALFAVEAALFEVLRAFGVTPAHLLGHSI
GEVTAAYVAGVWSLGDACRVVAARARLMQALPSGGAMAAVGLPEAEIAGLLPETVSIAAV
NTADSVVVSGPREAVDSVVAVVSARGAEVTRLRVSHAFHSSLTHPMLEDFRQVLGSVRFA
PPRIPVVSNLTGERASDEELCSPEYWVRQVRSAVRFADGVRWLAGHGVAAMVELGPDGVL
SGLARQSCASVAVPMLRRQGTSERNEAATVVAALAQLHAQGVPVDWNTLFAGQAAARIPL
PPYAFRHERYWLDGSNRAADVSSAGLTAAEHPLLGAMLSLPQTDGFVFTSRLSRRTYPWP
AEHPVGGSAVLPATAYVELAVRAGDSAGCDRLDELVVEAPLALPARGGVQLQVVVGDRVD
GRREVAVYARPDGEETWTRHATGTLSTGSSDADGDDPVAALGREWPVPGATAVDLGDTSG
RGPLVPDVTGVWTRGDQVFAEVELPESEHDLAASFGIHPALLDAALRTAALAQPAQSAAV
PAAFGDVVLRASGAARLRVALTRTGPDEISVAVADGAGLPVLSIGSVIARRMDSATPSTG
DRSVLAVEWVGITPAAGADLRDWLLAGPDDARFADLTAPGEERPVPQAVVLAVSGAADAV
VESTHELTGRVLRLLQHWLADGRFSAVPLVVLTSGAVAAGPDEGVRDLAAAAVWGLVRSA
QTENPGRFVLLDSDAEPDTTTVSRVLASGEPQVVIREGRMHAARLVRTEPGEHAFTPPEP
GTVVITGGTGALGGVVARHLVGARGVRHLLLLSRRGMAAAGAADLVGELAALGAEVTVAA
CDVTDRQALAEVLGAVPPERPVTGVVHTAGVVDDGVLGSLSQEQVDRVLAPKVDAAWHLH
ELTRDLDLSLFAVFSSIGGSLGSGGQANYAAGNVFLDALMQQRRHAGLPGLSMAWGPWTT
EIGMTGTLSDGDRRRIARSAIPPLTPAQGMELFERALVTDRPVLVLTRLNLSALRAQTEV
APVWRSLAGGVRRRRADDGTGGRDGLRQRLAGLSEADGLRLLIGFVRDSAAAVLGHAPEA
RIEADQPFSELGFDSLTAVELRNLVQARTGLAMPASLVFDYPTVGHVARYLAAEFGDVRP
EVPSAVRELVSVADDPVVLVGMACRFPGGVSGPEELWRLVADGADGITPFPANRGWNLDA
LLGLDGSGSSATGEGGFIDEVGDFDAAFFRISPREALATDPQQRLLLEVSWEALEQAGIK
PASLAGSSTGVYVGAYQSGYAELVSRSDGQLLGHALTGGAGSVISGRIAYTLGLEGPAVS
VDTACSSSLVAMHLAAQALRAGECSLALAGGVTLMASPDTFVGFSVQGGLAADGRCKSFA
DAADGTGWAEGVGVVVLERLSDARRNDHEVLAVLRSSAVNQDGASNGLTAPNGPSQQRVI
RQALAAAGLSASDIDAVEAHGTGTKLGDPIEAQALLATYGQDRPAERPLWLGSLKSNIGH
TQAAAGVGGVIKMVMALRRGVLPKTLHVDAPSTQVDWAQGDVRLLTESVPWPETDHPRRA
GVSSFGVSGTNAHVILEAADTAAASPGVDPGGVVPWVLSGKTEEALRAQAARLLAHLESD
APWRPVDVGWSLIDSRTVFEHRAVVVGTDQDELLTGARAVAAGEPAAGLTEGVARAGDGV
VFVFPGQGAQWVGMAQDLLAESPVFAESMRECAEALAPFVDWSLEQVLGDEAALARADVV
QPVLWAVMVSLAAVWRSFGVEPAAVVGHSQGEIAAACVAGALSLSDGARVVVLRSRAIAD
TLAGGGGMVALPMPVTEVGELISQRPAVSVAAINGPASVVVAGEPGALDRLLADCEGDGI
QARRIAVDYASHSPSVERIEDRLLADLAPVSPRSSTVPVYSSVTGQLADTASWDARYWYD
NLRNPVLFETALGAALDAGPDLVIEVGPHPVLVPAVQDIAQQRGKPVAAVGTLRRDSGTL
RRVVLSVAHACALGAEVDWARVFADRGARRVPLPTYAFQRRRFWPDTTGGRADVSAAGLT
AADHPLLGAMLPLPQTDGVVFTSRLSLRTHPWLADHAVRDAVVFPGTGYVELAIRAGDSV
GCDRLDELVLEAPLVLPAHAGVQLQVVVGALDAPAEAEARSVAVYARVDGEESWTRHATG
VVSAGSGEAGGTELFDPVSRDWPGPGATALDTDYFYDRLADEGFLRYGPVFRGLTQAWQC
GDRVLAEVELPESGRGPAESFGIHPALLDAALHASVFAGLEARGALPFSFTGVVLRASGA
SRLRVALTRTGPDEVGVVVADSSGSPVLSIGSLAVRAASTGSLSAVPGDGALLKVGWIAA
DGPVVPVPVADWLLVDRASSTGTAYADLAEVSAATADGARPQAVVLAVAGDRDAVVDSVH
ELTAWVLGQLQHWLAEDRFASIPLVVAVRGAVTVEDGESVRDLAAAAVWGLVRSAQTENP
GRIVLLDTDTELDHDVLGRVLSTDEPQLALRGTRLHAARLARVRSADDLVAPETEAWRLE
SVEKGTLENLALVPCPEVTNPLRPGQVRIEVRVAGLNFRDVLNALGMYRGQAGPLGSEVA
GVVTEVGPEVTGLAPGDRVMGLAFGGFGPVAVTDRRLLTVIPAGWSFAVAASVPIVFLTA
YYGLVDLAGLRAGESLLVHAGAGGVGLAAIQLGRHLGAEVYATASEGKWGVLHEWGVDES
RVASSRTLDFRERFRAATDGRGVDVVLNSLAGEFVDASLDLLVPSGRFVEMGKSDIRSAE
DLRDRCADLNYQAFELTDAGFERIQQMLRELVSLFEAGVLRPLPVRSWDVRQAQDAFRFM
SQAKHVGKLVLTVPRAPDSSGTVVITGAGGLGGALARHLAGEYGVRHLLLVSRRGSAAPG
APALVTELAAQGVTVTFAACDLTDREALAAVLAGVPAERPVTGVVHTAGILEDGVLGSLS
PDQLDRVLAPKVDAAWHLHELTRDLDLSFFVVFSSLAGLLGSGGQANYAAGNMFLDSLVQ
HRREQGLPGSSMAWGAWTTEVGLVGTLSSADLRRIERSALPPFSVAQGMDLFDRAMRSSR
PVLGLARLNARALRAQQDVPALWRSLAGAVPRRTADNTRDGRGGPGQRLAELSVGEREQA
LAELVRESAAAVLGHGSGAQIDADRPFRELGFDSLTSVELRNLLRAKTGAVLAASVVFDY
PTVTRLARHLAAGFGAGQPAEPTAVPASVSVSDDPIVLVGMACRFPGGVAGPDDLWRLVA
DGADGVTPFPADRGWNLDTLIGREGPGSGTSATGEGGFLAGVDEFDAAFFRISPREALAT
DPQQRLLLEVSWEALEQAGIDPTSLAGSPTGVFAGAYQSGYGEMVARGSDQLLGHQMTGG
ATSVISGRVSYTLGLEGPAVSVDTACSSSLVAMHLAAQALRAGECTLALAGGVTVMASPD
TFVGFTVQGGMAADGRCKSFSDAADGAGWAEGVGVVVMERLSEARRNGHEVLAVFRSSAV
NQDGASNGLTAPNGPSQQRVIRQALAAAGLSTADIDTVEAHGTGTRLGDPIEAQAVLATY
GQDRPEGRPLWLGSLKSNIGHAQAAAGVGGVIKMVMALRHGVLPRTLHVDRPSTQVDWTQ
GDVRLLTEAVPWPETGRPRRAGVSSFGISGTNAHVILEAPARTDVVPADDTGAAVPWVLS
GKSAEAVRAQASRLLGFVAADPTLRPVDVGWSLVGSRAVFDHRAVVVGGERAELLAGLRA
VAAGESVPGTVRPGTRLGVLFTGQGAQRVGMARDLFDQSPVFAAAVEEILAELDPLLERP
LREVMWGEDAELINETGWAQPALFVVEAALFEVLRAFGVTPDYLLGHSIGEVTAAYVSGV
WSLADACRVVAARARLMQALPSGGVMAALEISEAEIADLLPDGVSVAAVNTDDSVVVSGP
RAEVDRVVAAVGERPRRVSRLRVSHAFHSALLDPMLGEFMRVLESVRFAEPRIPVVSDVT
GRVATAEQLCSPEYWARQVRVPVRFADGVRWLAEQGVTAMVELGPDGVLSALAQRSCAPG
TVVTPVLRREHSDTSTLLSAIGQLYTRGVAVDWTAAFAGRGGTRISLPTYAFQRQRFWPD
AAGGRAEASAGLRSADHPLLGAVLSLPQFDGVVFTSRLSLRTHPWLADHAVLDEVVLPGA
AYVELAIRAGDSVGCGRLDELVLEAPLVLPVRGGMELQVVVGGADAPEPEGRRSVTIHAR
PDGAETWTRHATGVVSAASLPTRADGLFQAVGGTWPVPGATPADVERVYDRLADLGLEYG
PVFRGLTEAWESGDRIFAEVDLPESARGMAGSFGIHPALLDAASHPVAVAGADSVGSGRL
PFRFTDVVLRASGAARLRVALMRLGPDQVAMAAADNTGMPVLSIGSLAVRAPVAGSRTAG
DEALLRLEWLETTGTAAPVSEWLTVEAAFERETAPQAVVLNVSGDPDAVVVSVHDLTGRV
GGRLRHWLDEDRFTAVPLVVVTRGAVAVEPCEPVSDVAAAAVWGLVRSVQAENPGRLILL
DTDADLDADALGRVVAADEPQLALRRGRLHAARLTRTGDTDGPVTSLVSGTVVITDGERA
RVVARHLVAEHGVRRLLLLGRRGPDEPETAELVAELAQQGAEVTVTACDVTDRRALAEVL
ASGPADQPLIGVVHTAEARSLPEEGSDPVPGPTADAAWHLHELTRDQDLALFVMFSSFAG
LEGSGGHGGDAAFLAALARHRRDQGLPGLSIAWDDRAGEPELTAAREMALFDRALGTGEG
VLAATRLDVRAMRARPECPAVWRSLAGGPRRRAADNSRPDREGLRQRLAGLSEVDREEVL
IDVVREAVAAVLGHTSGVSIDPDRLFGELGFDSLTAVELRNSLQAKTGVELAATLVFDHP
DLRSLATELDTVLSELPRAGDGGGPLPEHHDLFGELYLQAIENGRPELGEELMIKAARLR
EKFDDPAQVKAKPAVVRISPAGEGPHLICVCPTVMTTGPQVYLRFAAELTGRGNQVSALV
PPGFAAGELLPATRAALVTGLADTVEEFVGETEFSLAGHSSGGVVAYELAQELHARGLAP
AGLVLLDTYTLNLKGERGVFDDEALQHALNTRLVEYVRRMGFGTLSERITAQLWNLDLLR
GWRPEGISVPSLYIRSTQALAHGQGDEWRDEVAAAADSVVEVPGDHFTMLEPEQVSSTAR
AVGEWLGNVR
selected fasta
>polyketide synthase [type I modular polyketide synthase]
ATGACTGTGCCCGTAGACAAGTTGACGGAGGCGCTCCGTGTTTCGTTGCTGGCCAACAGC
CGGCTGCGCGAAGAGAACCGGGCACTGGTGGACGCCACGAACGAGCCGATCGCGCTCGTG
GGAATGGCGTGCCGGTTCCCGGGCGGGGTGCGCGGGCCGGAGGATCTGTGGCGGCTGGTC
GCCGACGGCGTGGACGGCGTCGGCCCGTTCCCCGCGGACCGAGGCTGGGACCTGGACACT
CTGCTGGGCCCGGACGGCTCCGGTTCCGGGACCTCGGCGACCGGCGAGGGCGGGTTCCTG
GACGAGCCGGGCGAGTTCGACGCCGCGTTCTTCCGGATCTCGCCGAGAGAGGCGGTGGCC
ACCGACCCGCAGCAGCGGTTGCTGCTGGAGGTGTCGTGGGAAGCCCTCGAACACGCGGGC
ATCGACCCGAGTTCGCTGGCCGGAAGCCGGACCGGCGTGTTCACCGGCGCCTACCAGTCC
GGCTACGCCGAGCTGGTCGCCCGGGGCGGCGAGCAGTTGCGGGCCCACCAGATCACCGGC
GGCGCGGGTAGCGTGATCTCGGGACGGATCGCCTACACGCTCGGGCTCGAGGGCCCGGCG
GTGAGTGTGGACACGGCGTGTTCGTCGTCGTTGGTGGCGATGCACCTGGCCGCACAGGCG
CTGCGGGCCGGGGACTGCACGCTGGCTCTCGCCGGTGGGGTCACGGTGATGGCCTCACCC
GGCATGTTCCTGGGTTTCACCGCACAGGGCGGGCTCGCCGCGGACGGCCGGTGCAAGTCC
TTCTCCGACGGCGCCGACGGCACCGGGTGGGCGGAGGGCGCCGGCGTGGTGGTGCTGGAG
CGGTTGTCGGATGCTCGTCGGCACGGCCATGAGGTGCTGGCGGTGCTGCGGTCGAGTGCG
GTGAACCAGGACGGCGCTTCCAACGGCCTGACGGCGCCGAACGGGCCGTCGCAGCAGCGC
GTGATCCGCCAGGCGTTGGCGGCGGCCGGTCTGTCCGCCTCGGACGTCGATGTGGTCGAG
GCGCACGGCACCGGAACGCGGCTGGGTGATCCGATCGAGGCGCAGGCGGTCCTGGCGACC
TATGGTCAGGACCGGCCCGAGGGACGGCCGCTGTGGCTGGGGTCGTTGAAGTCGAACATC
GGACACGCCCAGGCCGCCGCCGGTGTCGGTGGTGTGATCAAAACGGTGCTGGCGCTGCGG
CACGGGATATTGCCGAAGACGCTGCACGTGGACGAACCGTCGAGGCAGGTGGACTGGTCC
CAGGGCGACGTACGCCTGCTCACGGAGGCGATGCCGTGGCCGGAGACCGGCCGCCCCCGC
CGGGCCGGGGTGTCGTCGTTCGGCGTCAGCGGCACGAATGCCCACGTGATCCTCGAAGCC
GCGGGCGAAGCCGCTGTCGGTCCCGCCGGACCGCCTTCCGGGCCGCCTGCCGTCGAGGGC
GTGGTGCCGTGGGTGGTGTCGGGCAAGTCGGCCGACGCCGTGCGGGCCCAGGCGGCCCGA
TTGCTCGAACGGCTCCAGGCGGAGCCGGCGCTGAGCCCGGCCGACGTGGGCTGGTCGTTG
CTCACCTCACGCGCGGCTTTTGACCACCGCGCCGTGGTGGTGGGCGGCGACCGGACCGAG
CTGATGGCGGGCCTGCGCGCCACGGCGGACGGCGAGCCCGCCGCGAACGTGGCCCTGGGT
ACTGCCCGGAGCGGGGCCAAACTCGGTGTCCTGTTCACGGGCCAGGGTGCGCAGCGGGTG
GGGATGGCCCGCGAGCTGTACGACCGTTCGCCGGTGTTCGCGGGAGCGTTGGACGAGATC
CTCGTCGAGCTCGATCCGTTGTTGGACCGGCCGTTGTGTGAGGTGATGTGGGGCGAGGAC
GCGGAGCTGATCAACGAGACGGGCTGGGCGCAGCCCGCGTTGTTCGCGGTCGAGGCGGCC
TTGTTCGAGGTGCTGCGCGCGTTCGGCGTGACCCCGGCCCATCTCCTGGGGCATTCGATC
GGTGAGGTCACGGCCGCGTACGTGGCCGGGGTGTGGTCGCTCGGTGACGCGTGCCGGGTG
GTGGCGGCGCGGGCGCGGTTGATGCAGGCGTTGCCGTCCGGCGGAGCGATGGCCGCCGTC
GGGCTGCCCGAGGCGGAGATCGCCGGGCTGCTGCCCGAAACCGTGTCGATCGCCGCGGTC
AACACCGCGGATTCGGTGGTGGTCTCGGGGCCGCGAGAAGCCGTGGACTCAGTCGTCGCG
GTCGTGTCCGCTCGTGGTGCCGAGGTGACGCGGTTGCGGGTGTCGCACGCGTTCCACTCG
TCGTTGACGCATCCGATGCTGGAGGACTTCCGGCAGGTTCTGGGATCGGTGCGGTTTGCG
CCGCCGCGGATTCCCGTGGTGTCCAATCTGACCGGGGAGCGGGCGTCCGACGAGGAGTTG
TGTTCGCCGGAGTACTGGGTGCGGCAGGTGCGGTCGGCGGTGCGGTTCGCCGACGGTGTG
CGGTGGCTGGCCGGCCACGGCGTCGCGGCGATGGTCGAGCTGGGCCCGGACGGGGTCCTG
TCGGGCCTGGCGCGGCAGAGCTGCGCGTCCGTCGCGGTGCCGATGCTGCGTCGGCAGGGA
ACCTCCGAACGCAACGAGGCCGCGACGGTGGTGGCGGCCCTCGCGCAGCTGCACGCGCAG
GGCGTGCCGGTGGACTGGAACACTCTCTTCGCCGGGCAGGCCGCCGCGCGGATTCCGTTG
CCGCCGTACGCGTTCCGGCACGAGCGCTACTGGCTCGACGGCTCGAACCGGGCGGCCGAC
GTGTCCTCGGCCGGGCTGACCGCCGCGGAGCACCCGTTGCTGGGTGCGATGCTGTCGCTT
CCACAGACGGACGGGTTCGTGTTCACCAGCCGTCTGTCCCGGCGCACGTATCCCTGGCCG
GCCGAGCATCCGGTGGGAGGCTCGGCGGTGCTGCCGGCCACCGCCTACGTCGAGCTGGCC
GTGCGCGCCGGTGACAGCGCCGGGTGCGACCGGCTGGACGAGCTGGTGGTGGAGGCTCCG
CTGGCGCTGCCCGCTCGCGGCGGTGTCCAGCTGCAGGTTGTGGTCGGCGACCGCGTGGAT
GGGCGCCGCGAGGTGGCGGTGTACGCCCGGCCGGACGGTGAGGAGACCTGGACCCGGCAT
GCCACGGGGACGCTGAGCACCGGATCGTCCGATGCAGACGGTGACGACCCGGTTGCCGCA
TTGGGTCGGGAATGGCCGGTGCCCGGTGCGACGGCCGTGGACCTCGGCGACACCTCTGGG
CGCGGCCCGCTCGTCCCCGACGTGACCGGGGTCTGGACCCGCGGCGACCAGGTGTTCGCC
GAAGTCGAGCTGCCGGAGTCCGAGCACGACCTGGCAGCGTCCTTCGGCATCCACCCGGCG
CTGCTGGACGCGGCTCTGCGGACGGCGGCCCTCGCGCAGCCGGCGCAGAGCGCGGCGGTC
CCGGCCGCCTTCGGCGACGTGGTGTTGCGCGCGTCCGGCGCGGCGCGGCTCCGCGTGGCC
TTGACCCGGACCGGCCCGGACGAGATCTCGGTCGCCGTGGCGGACGGCGCGGGACTGCCG
GTGTTGTCGATCGGGTCGGTGATCGCGCGGCGGATGGACAGTGCGACCCCCAGCACGGGC
GACCGGTCCGTCCTCGCCGTGGAGTGGGTCGGGATCACTCCGGCGGCCGGCGCGGATCTG
CGTGACTGGCTGCTGGCCGGCCCGGACGACGCTCGCTTCGCGGACCTGACCGCGCCCGGC
GAGGAGAGGCCGGTACCGCAGGCGGTGGTGCTGGCCGTGTCCGGTGCCGCGGACGCGGTG
GTGGAGTCGACGCACGAGCTGACCGGACGCGTCCTGCGGCTGCTGCAGCACTGGTTGGCC
GACGGCCGGTTCTCGGCTGTCCCGCTGGTGGTCCTGACTTCGGGAGCCGTCGCCGCCGGG
CCGGACGAAGGGGTGCGGGACCTGGCCGCGGCCGCGGTGTGGGGCCTGGTGAGGTCGGCC
CAGACGGAGAATCCCGGCCGGTTCGTGCTGCTCGACTCGGACGCCGAGCCGGACACCACG
ACCGTGAGCCGGGTCCTGGCCTCGGGCGAACCGCAGGTGGTGATCCGCGAAGGCCGGATG
CACGCGGCCCGGCTCGTCCGCACCGAGCCCGGCGAACACGCCTTCACGCCGCCCGAGCCG
GGCACCGTGGTGATCACCGGTGGGACCGGCGCTCTGGGCGGTGTCGTGGCCCGGCACCTC
GTCGGTGCGCGCGGGGTCCGGCACCTGTTGCTGCTGAGCCGTCGGGGAATGGCCGCCGCG
GGAGCCGCGGACCTGGTCGGGGAGTTGGCGGCGCTGGGGGCGGAGGTGACCGTCGCGGCG
TGCGACGTGACGGACCGGCAGGCCCTCGCGGAGGTGCTGGGGGCGGTTCCGCCGGAGCGG
CCGGTGACCGGTGTCGTCCACACGGCCGGTGTGGTCGACGACGGCGTGCTCGGTTCCTTG
TCACAGGAGCAGGTCGACCGGGTGCTGGCGCCGAAGGTGGACGCGGCGTGGCACCTGCAC
GAACTGACCCGGGACCTCGATCTCTCGCTGTTCGCGGTGTTCTCCTCCATCGGCGGCTCG
CTCGGCAGCGGCGGGCAGGCGAACTACGCGGCGGGCAACGTGTTCCTGGACGCGTTGATG
CAGCAGCGCCGGCACGCCGGGCTGCCGGGGCTGTCGATGGCGTGGGGTCCGTGGACCACG
GAGATCGGCATGACCGGCACGTTGTCCGACGGGGACCGTCGGCGCATCGCCCGCTCGGCG
ATCCCGCCGCTGACGCCCGCGCAGGGCATGGAGCTGTTCGAGCGCGCACTGGTCACCGAT
CGGCCCGTGCTGGTGCTGACCCGGTTGAACCTGTCCGCGTTGCGCGCTCAGACGGAGGTC
GCGCCCGTGTGGCGTTCGCTCGCCGGTGGCGTGCGCCGCCGGCGGGCGGACGACGGGACC
GGCGGCCGGGACGGCCTGCGACAGCGGCTCGCCGGACTGTCCGAAGCGGACGGACTGCGG
CTGCTGATCGGTTTCGTCCGGGACAGCGCCGCAGCCGTGCTCGGTCACGCGCCGGAGGCG
CGGATCGAGGCGGACCAGCCGTTCAGCGAGCTGGGCTTCGACTCGCTGACCGCGGTCGAG
CTGCGGAATCTGGTGCAGGCCAGGACCGGGCTGGCGATGCCCGCGAGCCTGGTGTTCGAC
TACCCGACCGTCGGCCACGTCGCGCGTTACCTGGCGGCCGAGTTCGGCGACGTGCGCCCG
GAGGTGCCGTCCGCGGTGCGGGAGTTGGTGTCGGTCGCCGACGATCCCGTTGTGCTGGTG
GGGATGGCGTGCCGGTTCCCGGGTGGGGTGTCGGGTCCGGAGGAGCTGTGGCGCCTGGTC
GCCGATGGCGCCGACGGAATTACGCCGTTCCCGGCCAATCGCGGCTGGAACCTGGACGCG
TTGCTGGGACTCGACGGCTCCGGATCGTCCGCGACCGGGGAAGGCGGGTTCATCGACGAG
GTCGGCGACTTCGACGCGGCCTTCTTCCGGATCTCGCCGCGGGAGGCGCTGGCCACCGAC
CCGCAGCAGCGGTTGCTGCTGGAGGTGTCGTGGGAAGCCTTGGAACAGGCCGGGATCAAG
CCCGCGTCCCTGGCCGGCAGCTCGACCGGCGTGTACGTCGGCGCGTACCAGTCCGGGTAC
GCCGAGCTGGTTTCCCGCTCCGACGGACAGCTGCTGGGCCACGCCCTCACCGGCGGCGCA
GGCAGTGTGATCTCCGGCCGGATCGCCTACACACTGGGCTTGGAAGGCCCTGCGGTGAGC
GTGGACACGGCCTGTTCGTCGTCGTTGGTGGCCATGCACCTGGCGGCTCAGGCATTGCGG
GCGGGGGAGTGCTCGCTCGCGCTGGCCGGTGGTGTCACGCTCATGGCTTCACCGGACACG
TTCGTCGGCTTCAGCGTGCAGGGTGGCCTGGCCGCCGACGGGCGGTGCAAGTCGTTCGCG
GATGCGGCCGACGGCACCGGCTGGGCCGAGGGCGTCGGCGTGGTGGTGCTGGAGAGGCTC
TCCGACGCCCGGCGGAACGATCACGAAGTTCTGGCTGTGCTGCGCTCGAGCGCGGTGAAC
CAGGACGGTGCGTCGAACGGGTTGACGGCGCCGAACGGTCCTTCGCAGCAACGGGTGATC
CGGCAAGCACTGGCCGCGGCAGGACTGTCCGCTTCGGACATCGATGCCGTGGAAGCCCAC
GGTACGGGTACGAAGCTCGGTGATCCGATCGAGGCGCAGGCGTTGCTGGCGACCTACGGC
CAGGATCGGCCCGCGGAGCGGCCGTTGTGGCTGGGCTCGTTGAAGTCGAACATCGGCCAC
ACGCAAGCGGCGGCCGGTGTCGGTGGTGTGATCAAGATGGTCATGGCGTTGCGGCGCGGT
GTGTTGCCGAAAACGCTGCACGTGGACGCGCCGTCGACGCAGGTGGATTGGGCGCAAGGC
GACGTCCGGCTGCTGACGGAGTCGGTGCCGTGGCCGGAAACAGACCACCCTCGGCGGGCC
GGGGTGTCCTCGTTCGGCGTCAGCGGCACCAATGCGCACGTCATCCTCGAAGCGGCCGAC
ACCGCCGCCGCCTCACCCGGCGTCGACCCCGGCGGTGTCGTGCCGTGGGTGCTGTCCGGC
AAGACGGAAGAGGCGCTGCGGGCGCAGGCAGCGCGCTTGCTGGCGCACCTCGAATCCGAT
GCGCCGTGGCGTCCGGTGGATGTGGGCTGGTCGCTGATCGACTCGCGGACGGTGTTCGAG
CACCGGGCTGTTGTCGTGGGCACCGATCAGGACGAGCTGCTGACCGGAGCGCGCGCTGTC
GCCGCCGGCGAACCCGCCGCGGGTCTCACCGAAGGCGTCGCCCGGGCCGGTGACGGAGTG
GTGTTCGTGTTCCCGGGCCAGGGTGCCCAATGGGTGGGGATGGCTCAGGACCTGCTGGCC
GAGTCGCCGGTGTTCGCCGAGTCGATGCGCGAGTGTGCGGAGGCGTTGGCGCCGTTCGTC
GACTGGTCGCTGGAGCAGGTGCTCGGTGACGAGGCCGCGTTGGCGCGAGCCGACGTCGTG
CAGCCGGTGCTGTGGGCGGTGATGGTGTCGTTGGCGGCGGTGTGGCGGTCGTTCGGGGTC
GAGCCGGCCGCGGTGGTGGGGCACTCGCAGGGTGAGATCGCGGCCGCGTGTGTGGCCGGT
GCTCTGTCCTTGTCGGACGGTGCTCGTGTTGTGGTGCTCCGCAGCCGGGCGATCGCCGAC
ACCCTGGCCGGTGGTGGGGGCATGGTGGCCTTGCCGATGCCGGTCACCGAGGTCGGGGAA
CTGATCTCGCAACGGCCGGCGGTTTCGGTGGCCGCGATCAACGGCCCGGCATCCGTGGTG
GTCGCCGGGGAGCCGGGCGCCCTCGACCGGTTGCTGGCCGACTGCGAAGGCGACGGGATC
CAGGCGCGCCGGATCGCGGTGGACTACGCCTCGCACTCGCCGTCGGTGGAGCGGATCGAG
GATCGGCTGCTGGCGGACCTGGCCCCGGTCAGCCCCCGCTCGTCGACGGTTCCGGTCTAC
TCGTCGGTGACCGGGCAGCTCGCGGACACCGCGTCGTGGGACGCCCGGTACTGGTACGAC
AACCTGCGCAACCCGGTCCTGTTCGAAACGGCGCTCGGGGCCGCTCTCGACGCTGGTCCC
GACCTGGTGATCGAGGTTGGTCCGCATCCGGTGCTGGTCCCCGCGGTGCAGGACATCGCG
CAGCAGCGAGGGAAACCCGTGGCCGCGGTGGGAACACTTCGCCGCGACTCAGGAACCCTG
CGGCGAGTGGTCTTGTCGGTGGCCCACGCGTGTGCTCTGGGCGCCGAGGTGGACTGGGCG
CGGGTGTTCGCCGACCGCGGTGCGCGGCGGGTCCCGTTGCCGACGTACGCCTTCCAACGC
CGGAGGTTCTGGCCGGACACGACCGGCGGCCGGGCCGATGTGTCCGCGGCCGGGCTGACG
GCCGCGGACCACCCGCTGCTGGGGGCGATGCTGCCGCTGCCGCAGACCGACGGGGTGGTG
TTCACCAGCCGACTTTCCCTGCGGACGCATCCGTGGCTGGCGGATCACGCGGTGCGGGAC
GCGGTGGTCTTCCCCGGCACCGGGTACGTGGAGCTGGCGATCCGGGCAGGCGACAGCGTC
GGGTGTGACCGCCTCGACGAGCTCGTGCTGGAGGCGCCGCTCGTCCTGCCCGCGCACGCC
GGGGTTCAGCTGCAGGTGGTCGTGGGGGCCCTCGACGCTCCTGCCGAGGCCGAAGCGCGC
AGCGTCGCGGTGTATGCGCGAGTGGACGGCGAAGAGTCCTGGACCCGCCATGCCACGGGC
GTGGTGAGCGCAGGCTCGGGTGAGGCAGGCGGCACCGAGCTGTTCGACCCGGTGAGCCGC
GACTGGCCCGGGCCGGGCGCGACGGCACTCGACACCGACTACTTCTACGACAGGCTCGCC
GACGAGGGTTTCCTCCGGTACGGCCCGGTGTTCCGGGGGCTCACCCAGGCCTGGCAGTGC
GGGGACCGGGTTCTGGCCGAGGTCGAGCTGCCGGAGTCCGGGCGTGGTCCGGCCGAGTCG
TTCGGGATCCATCCGGCGCTGCTGGACGCGGCGTTGCACGCCTCGGTCTTCGCGGGGCTG
GAAGCGCGAGGAGCGTTGCCGTTCAGCTTCACCGGCGTGGTATTGCGCGCCTCGGGTGCG
TCCCGGCTCCGGGTGGCGTTGACCCGGACCGGACCCGACGAGGTCGGCGTCGTGGTCGCC
GACAGCAGCGGCTCACCGGTGTTGTCGATCGGCTCGCTGGCTGTGCGGGCCGCGTCGACC
GGCAGCCTCTCCGCCGTCCCGGGTGACGGTGCTCTGCTGAAGGTCGGCTGGATCGCCGCC
GATGGTCCGGTGGTGCCGGTGCCGGTGGCGGACTGGCTCCTGGTCGATCGCGCGAGTTCG
ACCGGCACCGCGTACGCCGACCTCGCCGAGGTCAGCGCCGCAACGGCGGACGGTGCTCGT
CCTCAGGCGGTGGTACTGGCTGTGGCCGGCGACCGGGACGCGGTGGTGGACTCCGTTCAC
GAACTGACCGCCTGGGTGCTGGGGCAGCTGCAGCACTGGCTGGCCGAGGATCGCTTCGCC
TCGATCCCGCTGGTGGTGGCGGTGCGGGGCGCGGTCACGGTCGAGGACGGCGAGTCGGTG
CGGGACCTGGCCGCGGCGGCGGTGTGGGGGCTGGTGCGCTCGGCACAGACCGAGAACCCC
GGCCGGATCGTCCTGCTCGACACCGACACCGAGCTGGACCACGACGTCCTGGGCCGGGTT
CTGAGCACCGACGAGCCGCAGCTCGCGTTGCGCGGCACGCGGCTGCACGCTGCCCGTCTG
GCGAGGGTCCGGTCGGCGGACGACCTGGTCGCACCGGAGACGGAAGCCTGGCGGCTGGAG
TCCGTGGAGAAGGGCACGCTGGAGAATCTCGCGTTGGTGCCGTGTCCCGAGGTGACGAAT
CCCCTGCGGCCCGGGCAGGTCCGGATCGAGGTGCGCGTGGCCGGCCTGAACTTCCGCGAC
GTGCTCAACGCCCTCGGCATGTACCGCGGTCAGGCCGGCCCCTTGGGCAGCGAGGTCGCC
GGGGTGGTCACCGAGGTCGGCCCGGAGGTGACCGGGCTGGCGCCCGGTGACCGGGTGATG
GGCCTGGCCTTCGGCGGCTTCGGCCCGGTGGCCGTGACCGACCGGCGGTTGCTGACGGTG
ATCCCGGCCGGCTGGTCGTTCGCCGTCGCCGCGTCGGTTCCGATCGTGTTCCTGACGGCG
TACTACGGCTTGGTGGACCTCGCGGGTCTGCGGGCGGGTGAGTCGCTGCTCGTGCACGCC
GGTGCCGGTGGCGTGGGCCTGGCGGCCATCCAGCTCGGCCGGCACCTCGGCGCGGAGGTC
TACGCAACCGCGAGCGAAGGCAAATGGGGTGTCCTGCACGAGTGGGGCGTCGACGAAAGC
CGGGTGGCTTCGTCGCGGACCTTGGACTTCCGGGAGCGCTTCCGCGCTGCCACGGACGGG
CGCGGCGTCGATGTGGTGCTCAACTCGCTGGCCGGCGAGTTCGTGGACGCCTCGCTGGAC
CTGCTCGTGCCGTCCGGCCGCTTCGTCGAGATGGGCAAGTCCGACATCCGCTCGGCCGAG
GACCTGCGGGACCGTTGCGCCGACTTGAACTACCAGGCCTTCGAACTGACCGACGCCGGG
TTCGAACGCATCCAGCAGATGCTGCGGGAACTGGTGAGCTTGTTCGAGGCCGGTGTGCTG
CGGCCGTTGCCGGTGCGCAGCTGGGACGTGCGTCAGGCCCAGGACGCCTTCCGGTTCATG
AGCCAGGCCAAGCACGTCGGCAAGCTGGTGCTCACCGTCCCACGGGCACCGGACTCCTCG
GGCACGGTCGTGATCACCGGCGCCGGCGGCCTGGGTGGTGCCCTGGCCCGCCACCTGGCC
GGCGAGTACGGTGTCCGGCACCTGCTGCTCGTCAGCCGGCGCGGCTCGGCCGCGCCGGGT
GCTCCAGCGCTGGTCACCGAGTTGGCGGCGCAGGGCGTGACGGTGACGTTCGCGGCGTGC
GACCTGACGGATCGGGAAGCCCTGGCCGCGGTGCTGGCCGGGGTTCCGGCGGAGCGCCCG
GTGACCGGGGTGGTGCACACCGCCGGGATCCTCGAGGACGGCGTACTCGGCTCGCTCTCG
CCGGATCAGCTCGATCGCGTGCTGGCGCCGAAGGTCGACGCGGCGTGGCACCTCCACGAG
CTGACGCGGGATCTGGACCTGTCGTTCTTCGTGGTGTTCTCCTCTCTCGCCGGGCTTCTG
GGCAGCGGCGGCCAGGCCAACTACGCCGCGGGCAACATGTTCCTCGACAGTTTGGTGCAG
CACCGCCGTGAGCAGGGGCTGCCGGGCTCGTCGATGGCCTGGGGCGCCTGGACGACCGAG
GTCGGGCTGGTGGGCACCTTGTCCTCGGCGGACCTTCGCCGCATCGAACGGTCGGCCCTG
CCGCCGTTCTCGGTGGCGCAGGGCATGGACCTGTTCGACCGGGCGATGCGCTCCAGCCGG
CCGGTGCTCGGACTGGCCCGGCTGAACGCACGGGCGTTGCGGGCTCAGCAGGACGTGCCG
GCCCTGTGGCGGTCGCTCGCCGGCGCCGTGCCGCGCCGCACTGCCGACAACACCCGCGAC
GGTCGGGGCGGGCCGGGGCAGCGGTTGGCGGAACTGTCCGTGGGGGAGCGTGAGCAGGCG
CTGGCGGAGCTGGTCCGGGAGTCCGCCGCGGCGGTGCTGGGACACGGCTCGGGGGCACAG
ATCGACGCGGACCGACCGTTCCGGGAGCTGGGCTTCGACTCGCTGACGTCGGTGGAGCTG
CGGAATCTGCTGCGGGCCAAGACGGGTGCGGTGCTGGCGGCGAGCGTGGTGTTCGACTAT
CCGACGGTCACGCGGCTGGCGAGACACCTGGCCGCCGGGTTCGGTGCCGGGCAGCCGGCG
GAGCCGACCGCGGTGCCGGCGTCGGTGTCGGTTTCCGACGACCCGATCGTGCTGGTCGGG
ATGGCGTGCCGGTTCCCGGGCGGTGTCGCGGGTCCGGACGACTTGTGGCGGCTGGTCGCC
GATGGCGCCGACGGCGTCACCCCGTTCCCGGCCGACCGCGGCTGGAACCTGGACACCCTG
ATCGGGCGTGAGGGACCTGGTTCCGGAACCTCGGCGACGGGGGAGGGCGGGTTCCTCGCC
GGTGTCGACGAGTTCGACGCGGCGTTCTTCCGGATCTCGCCGCGGGAGGCGCTCGCCACG
GATCCGCAGCAGCGGCTGCTGCTGGAGGTGTCGTGGGAAGCCCTGGAACAGGCGGGAATC
GATCCGACCTCGCTGGCGGGCAGCCCGACGGGCGTGTTCGCCGGCGCGTACCAGTCCGGA
TACGGCGAGATGGTCGCCCGCGGCAGCGACCAGCTGCTGGGCCACCAGATGACGGGTGGC
GCGACCAGCGTGATTTCCGGCCGGGTGTCCTACACGCTCGGTCTGGAGGGCCCGGCGGTG
AGTGTGGACACGGCGTGTTCGTCGTCGTTGGTGGCGATGCACCTGGCGGCGCAGGCGTTG
CGGGCGGGCGAGTGCACGCTGGCGCTGGCCGGCGGGGTGACCGTGATGGCCTCGCCGGAC
ACGTTCGTCGGCTTCACCGTGCAGGGCGGAATGGCCGCGGACGGCCGCTGCAAGTCCTTC
TCCGACGCCGCCGACGGCGCCGGCTGGGCCGAGGGCGTCGGTGTCGTCGTGATGGAACGG
CTGTCCGAGGCCCGCCGCAACGGGCACGAGGTCCTGGCTGTCTTCCGGTCGAGCGCGGTG
AACCAGGACGGTGCGTCGAACGGGCTGACGGCTCCGAACGGTCCGTCGCAGCAACGGGTG
ATCCGCCAGGCGCTCGCGGCGGCCGGACTGTCCACTGCGGACATCGACACCGTGGAAGCC
CACGGCACGGGCACCCGGCTCGGTGACCCGATCGAGGCGCAGGCGGTGCTGGCCACGTAC
GGTCAGGACCGGCCCGAGGGCCGGCCGTTGTGGCTGGGGTCGTTGAAGTCGAACATCGGC
CACGCGCAGGCGGCCGCGGGCGTCGGCGGCGTGATCAAGATGGTGATGGCGCTGCGCCAC
GGAGTCCTGCCCAGGACGTTGCACGTGGACCGGCCCTCCACCCAGGTCGACTGGACCCAG
GGTGACGTGCGGCTGCTGACCGAGGCGGTACCGTGGCCCGAAACCGGCCGTCCGCGGCGG
GCCGGCGTGTCGTCGTTCGGGATCAGCGGCACCAACGCGCACGTGATCCTCGAGGCTCCC
GCCCGCACCGACGTTGTCCCGGCCGACGACACCGGCGCTGCGGTGCCGTGGGTGCTGTCC
GGCAAGTCGGCCGAGGCGGTGCGGGCTCAGGCGTCCAGGTTGCTGGGGTTCGTGGCGGCG
GACCCGACCTTGCGTCCGGTGGATGTGGGCTGGTCGCTGGTCGGTTCGCGGGCGGTGTTC
GACCACCGCGCCGTGGTCGTGGGCGGCGAGCGGGCCGAGCTATTGGCGGGCTTGCGTGCG
GTCGCGGCCGGTGAATCCGTGCCCGGTACGGTTCGGCCGGGCACTCGGCTGGGTGTGCTG
TTCACGGGGCAGGGTGCTCAGCGGGTGGGGATGGCCCGGGACTTGTTCGACCAGTCCCCG
GTTTTCGCCGCCGCGGTGGAGGAGATCCTCGCGGAGCTGGATCCGTTGCTGGAGCGGCCG
TTGCGTGAGGTGATGTGGGGCGAGGACGCGGAGCTGATCAATGAGACAGGGTGGGCGCAG
CCGGCTCTGTTCGTGGTGGAAGCCGCGTTGTTCGAGGTGCTGCGCGCCTTCGGCGTGACC
CCGGATTACCTACTGGGGCATTCGATCGGTGAGGTGACCGCGGCGTACGTGTCAGGTGTG
TGGTCGCTGGCTGACGCGTGCCGGGTGGTGGCCGCGCGGGCACGGTTGATGCAGGCGTTG
CCATCCGGCGGCGTGATGGCCGCACTGGAGATTTCCGAGGCCGAGATCGCGGACCTGCTG
CCGGACGGCGTGTCGGTGGCCGCCGTGAACACCGACGATTCGGTGGTGGTCTCGGGTCCT
CGGGCCGAAGTGGACCGGGTGGTGGCGGCTGTGGGCGAGCGCCCCCGCCGGGTGTCGCGG
TTGCGGGTGTCGCACGCGTTCCATTCGGCGTTGCTGGACCCGATGCTGGGCGAGTTCATG
CGGGTGTTGGAGTCGGTGCGGTTCGCGGAGCCGCGGATTCCGGTGGTGTCCGATGTGACC
GGTCGGGTGGCGACGGCCGAGCAGTTGTGCTCGCCGGAGTACTGGGCCCGCCAGGTCCGA
GTGCCGGTGCGGTTCGCCGATGGTGTGCGGTGGCTGGCCGAGCAGGGTGTGACGGCGATG
GTCGAGCTGGGTCCGGACGGCGTGCTGTCCGCGCTGGCGCAGCGCAGCTGTGCTCCGGGG
ACGGTGGTGACGCCGGTCCTACGGCGCGAGCACAGCGACACGTCGACGCTGTTGTCGGCG
ATCGGACAGTTGTACACGCGAGGCGTGGCCGTGGACTGGACCGCGGCGTTCGCCGGTCGA
GGAGGCACCCGGATCAGCCTGCCGACCTACGCCTTCCAACGGCAGCGCTTCTGGCCCGAC
GCGGCCGGCGGCCGGGCCGAGGCCTCCGCCGGATTGCGGTCTGCGGACCACCCGTTGCTC
GGGGCGGTGCTGTCGTTGCCGCAGTTCGACGGTGTGGTCTTCACCAGCCGCCTGTCCCTG
CGGACCCACCCGTGGCTCGCCGATCACGCGGTGCTTGACGAGGTGGTGTTGCCCGGTGCG
GCGTACGTCGAGCTGGCGATCCGCGCCGGCGACAGCGTGGGCTGCGGTCGGCTGGACGAG
CTGGTGCTGGAAGCGCCGCTGGTGCTGCCCGTTCGAGGCGGCATGGAACTTCAGGTCGTG
GTCGGCGGTGCCGACGCCCCCGAACCCGAAGGGCGGCGGAGCGTCACGATCCACGCTCGC
CCGGACGGTGCAGAGACCTGGACCCGGCACGCCACCGGCGTGGTGAGCGCGGCTTCGCTG
CCGACTCGGGCGGACGGGTTGTTCCAAGCCGTCGGCGGGACCTGGCCGGTGCCCGGTGCG
ACGCCCGCGGATGTCGAGCGGGTCTACGACCGGCTCGCCGACCTCGGGCTCGAATATGGG
CCGGTGTTCCGTGGCCTGACCGAAGCCTGGGAGAGCGGGGACCGGATCTTCGCCGAGGTG
GATCTGCCCGAGTCCGCCCGCGGGATGGCGGGTTCGTTCGGGATCCATCCGGCTTTGCTG
GACGCCGCTTCACATCCGGTCGCCGTCGCGGGCGCGGACTCGGTCGGTTCCGGCCGGTTG
CCTTTCCGGTTCACCGACGTGGTGTTGCGAGCCTCGGGTGCGGCTCGGCTTCGGGTGGCG
CTGATGCGTCTCGGGCCGGACCAGGTGGCGATGGCCGCCGCGGACAACACCGGCATGCCG
GTGCTGTCGATCGGTTCGCTGGCCGTGCGGGCCCCGGTGGCAGGCAGCCGCACCGCCGGC
GACGAGGCGCTGCTGCGGCTGGAGTGGCTCGAGACCACCGGCACCGCGGCTCCGGTGAGC
GAGTGGCTGACGGTCGAAGCCGCTTTCGAGCGGGAGACGGCACCGCAGGCGGTCGTGCTC
AACGTGTCCGGTGACCCGGACGCCGTCGTGGTGTCCGTCCACGACTTGACCGGCCGGGTC
GGGGGCCGGCTGCGGCACTGGCTGGACGAGGACCGGTTCACCGCCGTCCCGCTGGTGGTG
GTCACGCGGGGTGCCGTCGCGGTCGAGCCCTGTGAGCCGGTGAGCGACGTGGCCGCGGCC
GCCGTGTGGGGTCTGGTGCGTTCGGTGCAGGCCGAGAACCCGGGCCGGCTCATCCTGCTC
GACACGGATGCCGACCTCGACGCCGACGCGCTGGGGCGAGTCGTGGCCGCCGACGAGCCG
CAGCTGGCCCTGCGCCGGGGCCGGCTCCACGCCGCCCGGCTCACCCGGACCGGCGACACC
GACGGACCGGTCACGTCACTGGTGTCGGGTACGGTCGTGATCACCGATGGTGAGCGGGCC
CGCGTGGTCGCGCGGCATCTGGTCGCCGAGCACGGTGTCCGGCGTTTGCTGCTGCTCGGT
CGACGCGGTCCGGACGAGCCGGAAACGGCGGAGCTGGTGGCGGAATTGGCTCAGCAGGGC
GCCGAAGTCACGGTCACCGCATGCGACGTGACCGATCGGCGAGCCTTGGCCGAGGTGCTG
GCCTCGGGTCCCGCGGATCAGCCGCTCATCGGCGTCGTGCACACCGCCGAGGCTCGCTCG
TTGCCCGAGGAGGGTTCGGACCCGGTGCCGGGGCCGACGGCCGACGCGGCTTGGCATCTG
CACGAACTGACCCGGGATCAGGATCTGGCACTGTTCGTGATGTTCTCGTCGTTCGCCGGC
CTTGAGGGCAGCGGCGGGCACGGCGGCGACGCCGCGTTTCTGGCCGCGCTGGCGCGGCAC
CGCCGTGATCAAGGCTTGCCGGGCTTGTCGATCGCCTGGGACGACCGGGCGGGCGAGCCG
GAGTTGACCGCGGCGCGGGAGATGGCGCTCTTCGACCGGGCGCTGGGCACCGGCGAAGGG
GTTCTGGCAGCGACCCGGCTGGATGTGCGGGCGATGCGGGCTCGGCCGGAATGCCCGGCG
GTGTGGCGGTCTCTGGCCGGTGGTCCACGCCGGCGGGCGGCCGACAACAGCCGGCCCGAT
CGCGAGGGGCTGAGGCAGCGGCTTGCCGGGCTGTCCGAAGTGGACCGCGAGGAGGTGCTG
ATCGACGTGGTCCGCGAGGCGGTGGCGGCGGTGCTGGGCCACACCTCGGGTGTGTCGATC
GATCCGGACCGGCTCTTCGGCGAGCTGGGTTTCGACTCGTTGACGGCGGTCGAACTGCGC
AACTCGCTGCAGGCCAAAACCGGCGTGGAGCTGGCCGCGACCCTGGTGTTCGACCACCCG
GACCTGCGCAGCCTGGCCACGGAGCTGGACACGGTGTTGTCCGAGCTGCCGCGGGCCGGC
GACGGCGGTGGTCCGCTTCCGGAACACCACGACCTGTTCGGTGAGCTCTACCTCCAGGCG
ATCGAGAACGGCCGGCCGGAGCTCGGCGAAGAACTCATGATCAAGGCCGCGCGGTTGCGC
GAGAAATTTGACGACCCGGCGCAGGTGAAGGCGAAGCCGGCCGTGGTCCGCATTTCCCCG
GCGGGGGAGGGGCCACACCTGATCTGCGTGTGCCCGACCGTCATGACCACCGGGCCACAG
GTCTACCTCCGGTTCGCGGCGGAGCTCACGGGCCGGGGAAACCAGGTGTCGGCCCTGGTG
CCTCCGGGGTTTGCCGCCGGCGAGCTCCTGCCCGCGACCCGGGCCGCGTTGGTGACCGGT
TTGGCCGACACGGTCGAGGAATTCGTGGGTGAGACGGAGTTCTCCCTGGCCGGGCACTCT
TCCGGTGGGGTGGTGGCGTACGAGCTCGCCCAGGAGCTGCACGCTCGTGGCCTGGCTCCC
GCCGGTCTCGTGCTGCTCGACACCTACACCTTGAACCTCAAGGGTGAGCGGGGCGTGTTC
GACGACGAGGCCCTGCAGCACGCGTTGAACACCAGGCTGGTCGAGTACGTGCGCCGGATG
GGCTTCGGCACGCTGTCCGAACGGATCACCGCGCAGCTGTGGAACCTCGATCTGCTCAGG
GGTTGGCGGCCCGAGGGGATTTCGGTGCCGTCGCTGTACATCCGCTCGACGCAGGCCCTC
GCGCACGGGCAAGGGGACGAATGGCGTGATGAAGTGGCCGCCGCGGCGGATTCGGTCGTC
GAAGTGCCCGGTGACCACTTCACCATGCTGGAACCGGAGCAGGTGAGCTCGACCGCCAGG
GCCGTCGGGGAATGGCTGGGGAACGTGCGATGA
[10] KS34..411
[10] AT571..883
[10] malonyl-CoA756..760
[10] dh931..1084
[10] KR1381..1561
[10] ACP1662..1732
[11] KS1755..2129
[11] AT2281..2595
[11] methylmalonyl-CoA2469..2473
[11] DH2644..2814
[11] ER3125..3431
[11] KR3441..3620
[11] ACP3717..3791
[12] KS3814..4190
[12] AT4340..4651
[12] malonyl-CoA4525..4529
[12] dh4697..4866
[12] kr5150..5316
[12] ACP5400..5470
[12] TE5548..5766
[10] KS100..1233
[10] AT1711..2649
[10] malonyl-CoA2266..2280
[10] dh2791..3252
[10] KR4141..4683
[10] ACP4984..5196
[11] KS5263..6387
[11] AT6841..7785
[11] methylmalonyl-CoA7405..7419
[11] DH7930..8442
[11] ER9373..10293
[11] KR10321..10860
[11] ACP11149..11373
[12] KS11440..12570
[12] AT13018..13953
[12] malonyl-CoA13573..13587
[12] dh14089..14598
[12] kr15448..15948
[12] ACP16198..16410
[12] TE16642..17298

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001031 Thioesterase (Domain)
 [5548-5766]  5.80000000000004e-23 PF00975
PF00975   Thioesterase
IPR001227 Acyl transferase domain (Domain)
 [569-688]  G3DSA:3.40.366.10 [755-859]  G3DSA:3.40.366.10 [2272-2401]  G3DSA:3.40.366.10 [2469-2582]  G3DSA:3.40.366.10 [4336-4460]  G3DSA:3.40.366.10 [4525-4640]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR002364 Quinone oxidoreductase/zeta-crystallin, conserved site (Conserved_site)
 [3253-3274]  PS01162
PS01162   QOR_ZETA_CRYSTAL
IPR006162 Phosphopantetheine attachment site (PTM)
 [1690-1705]  PS00012 [3749-3764]  PS00012 [5428-5443]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1662-1732]  PS50075 [3717-3791]  PS50075 [5400-5470]  PS50075
PS50075   ACP_DOMAIN
 [1666-1735]  9.20000000000001e-61 G3DSA:1.10.1200.10 [3719-3792]  9.20000000000001e-61 G3DSA:1.10.1200.10 [5400-5471]  9.20000000000001e-61 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1666-1731]  4.2e-13 PF00550 [3724-3790]  3.90000000000001e-12 PF00550 [5403-5468]  1.9e-12 PF00550
PF00550   PP-binding
 [1655-1771]  2.800005042611e-25 SSF47336 [3714-3830]  4.80000830876748e-27 SSF47336
SSF47336   ACP_like
IPR011032 GroES-like (Domain)
 [3114-3271]  4.70000326671387e-31 SSF50129
SSF50129   GroES_like
IPR013154 Alcohol dehydrogenase GroES-like (Domain)
 [3144-3201]  2e-07 PF08240
PF08240   ADH_N
IPR013968 Polyketide synthase, KR (Domain)
 [1381-1559]  1.2e-60 PF08659 [3441-3618]  2.89999999999999e-61 PF08659 [5150-5314]  6.09999999999996e-36 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [34-285]  2.39999999999997e-90 PF00109 [1755-2003]  1.10000000000001e-89 PF00109 [3814-4064]  3.19999999999996e-87 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [293-411]  1.09999999999999e-46 PF02801 [2011-2129]  9.09999999999992e-47 PF02801 [4072-4190]  4.70000000000003e-46 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [571-883]  2.4e-61 PF00698 [2281-2595]  1.29999999999998e-99 PF00698 [4340-4651]  2.70000000000002e-62 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [567-856]  6.19996040581186e-70 SSF52151 [2279-2580]  4.20003460493095e-67 SSF52151 [4336-4624]  5.6999970878395e-70 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [693-755]  1.69999922284049e-16 SSF55048 [2404-2468]  2.2999993566538e-16 SSF55048 [4462-4524]  1.49999977583352e-14 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [34-295]  G3DSA:3.40.47.10 [299-461]  G3DSA:3.40.47.10 [1754-2013]  G3DSA:3.40.47.10 [2017-2180]  G3DSA:3.40.47.10 [3813-4074]  G3DSA:3.40.47.10 [4078-4240]  G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [27-463]  4.10001399699315e-101 SSF53901 [1747-2181]  4.40002866058555e-98 SSF53901 [3813-4188]  3.60002015031011e-96 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1381-1567]  7.69999999999997e-85 G3DSA:3.40.50.720 [3261-3353]  1.1e-19 G3DSA:3.40.50.720 [3441-3621]  4.09999999999995e-82 G3DSA:3.40.50.720 [5161-5285]  4.09999999999995e-82 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [198-214]  PS00606 [1916-1932]  PS00606 [3977-3993]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [571-860]  3.49999466863949e-116 SM00827 [2283-2577]  2.99998750445706e-115 SM00827 [4340-4631]  2.39999798157263e-110 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1663-1735]  2.49999811956465e-31 SM00823 [3722-3794]  7.19999557654549e-31 SM00823 [5401-5473]  5.00000909915354e-28 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [931-1084]  1.49999648196323e-52 SM00826 [2644-2814]  2.0000139277205e-73 SM00826 [4697-4866]  1.50000965748778e-79 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [37-463]  SM00825 [1757-2181]  SM00825 [3816-4242]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1381-1561]  6.00001679190159e-60 SM00822 [3441-3620]  1.10000150671643e-61 SM00822 [5150-5316]  1.99999636034521e-26 SM00822
SM00822   PKS_KR
IPR020843 Polyketide synthase, enoylreductase (Domain)
 [3125-3431]  SM00829
SM00829   PKS_ER
SignalP No significant hit
TMHMM No significant hit